KEGG   Bacillus subtilis subsp. subtilis 168: BSU34250Help
Entry
BSU34250          CDS       T00010                                 

Gene name
epsL
Definition
(RefSeq) sugar transferase EpsL
  KO
K19428  sugar transferase EpsL [EC:2.-.-.-]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BSU34250 (epsL)
Enzymes [BR:bsu01000]
 2. Transferases
  2.-  
   2.-.-  
    2.-.-.-  
     BSU34250 (epsL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Bac_transf
Motif
Other DBs
NCBI-GeneID: 936365
NCBI-ProteinID: NP_391305
Pasteur: BG11871
BSORF: BG11871
UniProt: P71062
Position
complement(3516880..3517488)
Genome map
AA seq 202 aa AA seqDB search
MILKRLFDLTAAIFLLCCTSVIILFTIAVVRLKIGSPVFFKQVRPGLHGKPFTLYKFRTM
TDERDSKGNLLPDEVRLTKTGRLIRKLSIDELPQLLNVLKGDLSLVGPRPLLMDYLPLYT
EKQARRHEVKPGITGWAQINGRNAISWEKKFELDVWYVDNWSFFLDLKILCLTVRKVLVS
EGIQQTNHVTAERFTGSGDVSS
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
ttgatcctgaaacgactttttgatctgacggccgccatttttttgttgtgctgtacaagt
gtgatcattctgttcaccatcgccgttgtcaggctgaaaataggatcacctgtcttcttt
aagcaagtaaggccgggcctgcacggcaaaccgttcaccctatataagttccggacaatg
acggatgaacgggacagtaaaggaaatctgctgcctgatgaagtccggctgacgaaaacg
ggcaggctgatcagaaagctgagcattgatgagcttccgcagctcctgaatgtcctgaag
ggcgatctgagccttgtcgggccgcggccgcttttgatggactatctgcctctttataca
gaaaaacaggcacggcgccatgaggtgaagccgggtatcacaggctgggcgcaaatcaat
ggcagaaacgcgatttcctgggaaaagaaatttgaattagatgtttggtacgttgacaac
tggtcattttttctcgatttgaaaattttatgtttgacggtgcgaaaggtccttgtttca
gaagggattcagcaaaccaatcatgtgaccgcggaacggtttaccggaagcggagatgtg
tcctcatga

DBGET integrated database retrieval system