KEGG   Bacillus subtilis subsp. subtilis 168: BSU34265
Entry
BSU34265          CDS       T00010                                 

Symbol
epsK
Name
(RefSeq) membrane protein EpsK
  KO
K19418  membrane protein EpsK
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU34265 (epsK)
Transporters [BR:bsu02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   BSU34265 (epsK)
SSDB
Motif
Pfam: Polysacc_synt Polysacc_synt_C
Other DBs
NCBI-GeneID: 8302980
NCBI-ProteinID: YP_003097789
UniProt: P71060 A0A6M3ZGU6
Position
complement(3517485..3519002)
AA seq 505 aa
MKFTINFSANLTAFLLSVFLSVWMTPFIVKTLGVEAFGFVHLTQNVINYFSVITVALSSV
VVRFFSVAAHRGEREKANAYISNYLAASVLISLLLLLPLAGSAFFIDRVMNVPQALLADV
RLSILIGSVLFILTFLMAGFGAAPFYANRLYITSSIQAVQMLIRVLSVLLLFACFAPKIW
QIQLAALAGAVIASVLSFYFFKKLIPWFSFRMKDLSFRTSKELFQAGAWSSVNQIGVLLF
LQIDLLTANLMLGASASGKYAAIIQFPLLLRSLAGTVASLFAPIMTSYYSKGDMEGLMNY
ANKAVRLNGLLLALPAALLGGLAGPFLTIWLGPSFSTIAPLLFIHAGYLVVSLAFMPLFY
IWTAFNQQKTPAIVTLLLGAVNVVLAVTLSGPAHLGLYGITLAGAISLILKNAIFTPLYV
SRITGYKKHVFLKGIIGPLSAAVFAWTVCKAIQFIVKIDSWPSLIATGVTVSFCYAVFAF
MLVCTKEERQLVLKRFRKTKGAVNL
NT seq 1518 nt   +upstreamnt  +downstreamnt
atgaaattcacgataaatttcagcgcgaatctcacggcttttctcttgtctgttttccta
tcggtttggatgacgccttttattgtcaaaacgctcggtgtcgaagcgtttggctttgtt
cacttgacacaaaatgtgattaattacttttcggttattaccgtggcgctcagctcggtt
gtcgttcggttcttttctgttgctgcccacaggggagagcgggagaaagcaaatgcgtat
atcagcaattatttagccgcctctgttttgatttccttgctgctcttgctgccgcttgcg
ggttcggctttttttattgaccgcgtcatgaatgtgccgcaagcgcttttggcagatgtg
cgtttgtcgattttaatcggcagtgtgctgtttattttaacgtttctgatggcgggcttc
ggcgctgcaccattttatgccaaccgcctttatatcaccagttccattcaggcggtgcaa
atgcttatacgggtgctgtctgtgctgctcctgtttgcatgctttgcgccgaaaatctgg
cagatccagcttgcagctttagctggtgctgttattgcgtctgtgctgtctttctatttc
ttcaaaaagctgattccgtggttttcgtttcgtatgaaggatctttcattccgtacaagc
aaggagctgtttcaagcgggcgcatggagctccgtcaatcaaatcggcgtcctgcttttt
ttgcagattgatctgttaaccgccaatttgatgctgggggcgtctgcatccgggaaatac
gcggcgattatccagtttccgctgcttttgcgcagcttggccggaacggtcgcatccctg
tttgcgcccatcatgacttcatattattcaaaaggcgatatggaaggattgatgaattac
gccaataaggcagtaaggctcaatggtcttttgcttgcacttcctgctgccttattgggc
ggattggcgggaccttttctgacaatctggctcggaccgtccttttcaacgatagcaccg
cttttatttattcatgccggatacttggttgtcagcctcgcctttatgccgctgttttat
atatggaccgcttttaatcaacaaaaaacaccggcgattgttaccctgctgttaggtgcg
gtgaatgtggtgctggcggtcacgctgagcgggccggctcatctcggtctgtacggcata
acattggcaggggccatttctcttattttaaaaaatgccatctttacgccgctttacgta
tcccgcattacaggctacaaaaagcacgtgttccttaaaggcataatcgggcctctttca
gccgctgtatttgcctggacggtctgtaaggcaattcagttcattgtgaagattgacagc
tggccgtcattgatagcgacgggagtgacagtcagcttttgctacgctgttttcgctttt
atgctcgtttgtacaaaagaggaaagacagctggtattaaaacggtttcgaaaaacgaaa
ggagctgtgaatctttga

DBGET integrated database retrieval system