KEGG   Bacillus subtilis subsp. subtilis 168: BSU34280
Entry
BSU34280          CDS       T00010                                 

Symbol
epsJ
Name
(RefSeq) glycosyltransferase EpsJ
  KO
K19427  glycosyltransferase EpsJ [EC:2.4.-.-]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BSU34280 (epsJ)
Enzymes [BR:bsu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.-  Glycosyltransferases
    2.4.-.-  
     BSU34280 (epsJ)
SSDB
Motif
Pfam: Glycos_transf_2 Glyco_tranf_2_3 Glyco_tranf_2_2 Glyco_transf_49
Other DBs
NCBI-GeneID: 937131
NCBI-ProteinID: NP_391308
Pasteur: BG11868
BSORF: BG11868
UniProt: P71059 A0A6M3ZG77
Position
complement(3518999..3520033)
AA seq 344 aa
MIPLVSIIVPMYNVEPFIEECIDSLLRQTLSDIEIILVNDGTPDRSGEIAEDYAKRDARI
RVIHQANGGLSSARNTGIKAARGTYIGFVDGDDYVSSAMFQRLTEEAEQNQLDIVGCGFY
KQSSDRRTYVPPQLEANRVLTKPEMTEQLKHAHETRFIWYVWRYLYRRELFERANLLFDE
DIRFAEDSPFNLSAFREAERVKMLDEGLYIYRENPNSLTEIPYKPAMDEHLQKQYQAKIA
FYNHYGLAGACKEDLNVYICRHQLPMLLANACASPNSPKDIKKKIRQILSYDMVRQAVRH
TPFQHEKLLRGERLVLALCKWRLTFLIKLFFEQRGTMKGSAKQA
NT seq 1035 nt   +upstreamnt  +downstreamnt
atgatcccgctcgtcagcattattgtcccgatgtataatgttgaaccatttatagaagag
tgcattgattctttgcttcgtcaaacgctttctgatattgaaatcatcctcgtgaatgac
ggaacaccggatcgttcaggcgaaattgcagaggactatgcaaaacgggatgcgagaatc
cgggtcattcatcaggcaaacggcgggcttagttcagcgcgaaatacgggaataaaggcc
gcgcggggcacttacatcggctttgtagacggagacgattatgtatcatccgccatgttc
cagaggctgactgaagaagcggagcaaaatcagcttgacatcgtcggatgcggtttttac
aagcagtcatcggacaggcggacatatgtgccgccgcagcttgaggcaaaccgcgtgctg
acgaaaccagaaatgactgaacagcttaaacatgctcacgaaacgagatttatctggtat
gtatggcgttatctttaccgtcgtgagctttttgaaagggcgaatctgctgtttgatgaa
gacatccgttttgctgaagactctccctttaatttgtccgcttttcgcgaagcggagcgg
gtgaaaatgcttgatgaaggattgtacatttatcgtgaaaacccgaacagcctgacagaa
atcccttataagccggcgatggatgaacatcttcaaaaacaatatcaggctaaaatcgca
ttctacaatcactacggcttagcaggcgcatgtaaagaagatttgaatgtgtacatttgc
aggcaccagcttccgatgcttttggcaaatgcctgtgcttctccgaattcgccgaaagac
atcaaaaagaagatcagacagattttatcctatgacatggtgcggcaggctgtcagacat
acaccgtttcagcatgagaaattattaagaggagagcgtttggtattagcactgtgtaaa
tggcggctcacttttctcatcaagctgtttttcgagcagcgggggacaatgaaaggcagt
gcgaagcaggcatga

DBGET integrated database retrieval system