KEGG   Bacillus subtilis subsp. subtilis 168: BSU34290
Entry
BSU34290          CDS       T00010                                 

Symbol
epsI
Name
(RefSeq) pyruvyl transferase EpsI
  KO
K19426  pyruvyl transferase EpsI [EC:2.-.-.-]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BSU34290 (epsI)
Enzymes [BR:bsu01000]
 2. Transferases
  2.-  
   2.-.-  
    2.-.-.-  
     BSU34290 (epsI)
SSDB
Motif
Pfam: PS_pyruv_trans
Other DBs
NCBI-GeneID: 937256
NCBI-ProteinID: NP_391309
Pasteur: BG11867
BSORF: BG11867
UniProt: P71058 A0A6M3ZGJ1
Position
complement(3520030..3521106)
AA seq 358 aa
MSLQSLKINFAEWLLLKVKYPSQYWLGAADQPVKAAAHQKKIILTLLPSHDNLGDHAIAY
ASKAFLEQEYPDFDIVEVDMKDIYKSAKSLIRSRHPEDMVFIIGGGNMGDLYRYEEWTRR
FIIKTFHDYRVVQLPATAHFSDTKKGRKELKRAQKIYNAHPGLLLMARDETTYQFMKQHF
QEKTILKQPDMVLYLDRSKAPAEREGVYMCLREDQESVLQEEQRNRVKAALCEEFGEIKS
FTTTIGRRVSRDTREHELEALWSKLQSAEAVVTDRLHGMIFCALTGTPCVVIRSFDHKVM
EGYQWLKDIPFMKLIEHPEPERVTAAVNELLTKETSRAGFPRDVYFKGLRDKISGEAQ
NT seq 1077 nt   +upstreamnt  +downstreamnt
atgtcgttacaatcgttgaaaatcaattttgcagaatggctgctgctaaaggtcaaatac
ccgtcccaatattggctgggagcggcagatcaaccggtaaaggccgcagcacatcagaaa
aaaatcatactgaccctgctgccgtcccatgacaatttgggagatcacgcaattgcttat
gccagcaaggcatttcttgagcaagaatacccggactttgacatcgtcgaggtcgatatg
aaggacatttacaaatcagcaaaaagcctgatccgctcgcgccatccggaggatatggtc
tttatcatcggcggcggaaacatgggggatttataccgttatgaggagtggacgcgccgc
ttcatcattaaaacattccatgactatcgggttgtccagcttccggcaacggctcatttt
tctgacacgaaaaaagggcgcaaagagctgaaacgggcacagaaaatttataatgcgcac
cccggcctattgctgatggcgcgggatgaaacaacgtatcaatttatgaaacagcatttt
caagaaaaaacaattttgaagcagccggacatggtgctgtatttagacagaagcaaggct
cccgcagaacgcgaaggggtttatatgtgtttgcgcgaggatcaggaaagcgtgcttcag
gaggagcagaggaaccgggtcaaggctgcgctatgtgaggaattcggcgagatcaaatcc
tttacgacaacgatcggccgccgggtcagccgcgatacacgcgaacatgaacttgaagca
ctgtggtctaagctgcaaagcgcagaagccgtcgtcactgacaggcttcatggcatgatt
ttttgcgcgctgacaggaacgccgtgtgttgtcattcgctcctttgaccataaggtgatg
gagggctatcaatggcttaaagacatcccgttcatgaagctgatagaacatccggagcca
gagcgcgtaacagccgcagtcaatgagcttttaacaaaagaaacatcccgtgcaggcttt
ccgagagatgtgtattttaaaggtctgcgtgacaaaatcagcggtgaagcgcaatga

DBGET integrated database retrieval system