KEGG   Bacillus subtilis subsp. subtilis 168: BSU34300
Entry
BSU34300          CDS       T00010                                 

Symbol
epsH
Name
(RefSeq) glycosyltransferase EpsH
  KO
K19425  glycosyltransferase EpsH [EC:2.4.-.-]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:bsu01003]
    BSU34300 (epsH)
Enzymes [BR:bsu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.-  Glycosyltransferases
    2.4.-.-  
     BSU34300 (epsH)
Glycosyltransferases [BR:bsu01003]
 Polysaccharide
  Bacterial polysaccharide (excluding LPS)
   BSU34300 (epsH)
SSDB
Motif
Pfam: Glycos_transf_2 Glyco_tranf_2_3 Glyco_tranf_2_2 Glyco_tranf_2_4 Glyco_transf_21
Other DBs
NCBI-GeneID: 938630
NCBI-ProteinID: NP_391310
Pasteur: BG11866
BSORF: BG11866
UniProt: P71057 A0A6M3ZGG9
Position
complement(3521111..3522145)
AA seq 344 aa
METPAVSLLVAVYNTETYIRTCLESLRNQTMDNIEIIIVNDGSADASPDIAEEYAKMDNR
FKVIHQENQGLGAVRNKGIEAARGEFIAFIDSDDWIEPDYCEQMLRTAGDETDLVICNYA
AEFEDTGKTMDSDIAQTYQDQPKEHYIKALFEGKVRGFSWNKLYRRSMIEAHRLSFPLRG
ELEHVEDQFFSFRAHFFARSVSYVKTPLYHYRIHLSSIVQRYQKKLFESGLALYETNAAF
LQENNKLEEYRKELDTFIVLHSSICMLNEWKTSGSRRLFEKLRNVGVICADPVFQESLSK
TGTAPFDAKRSCLLLMAKYRMIPFVAMASAVYQRVIEYKMRNRG
NT seq 1035 nt   +upstreamnt  +downstreamnt
atggaaacacctgcggttagtctgttagtcgctgtttataacacagaaacatatatcaga
acgtgtctcgaatcactgcggaaccagacaatggacaatattgaaatcatcattgtcaat
gacggttcagctgacgccagcccggatatcgcagaagaatacgccaaaatggacaacagg
ttcaaggtgattcatcaggaaaaccagggactcggtgcggttcggaataaaggcattgaa
gctgcacgcggcgaatttatcgcgtttatcgattcagacgattggattgagcctgattat
tgcgagcagatgctccggacagcaggcgatgaaactgatctggtcatttgcaattacgcc
gcagagtttgaggacactggcaaaaccatggactctgacattgcccaaacctatcaggat
cagccgaaggagcactatatcaaggcgttattcgaagggaaggtcagagggttttcatgg
aacaaactgtacagaagaagcatgattgaagcccatcggctgtcgtttccgctccgaggc
gagctggagcatgtcgaggatcagtttttcagcttcagggctcattttttcgcccgctca
gtatcctacgtaaaaacgccgctctatcattatcgaattcacctttcctccattgtgcag
cgctatcagaaaaaattgtttgaatcaggacttgcgctgtatgagacgaatgcggcgttt
ttacaggagaacaacaaactggaggagtatcgcaaggagcttgatacctttatcgttctt
cacagcagcatctgtatgctgaatgaatggaaaacgagcggcagccgccggctgtttgaa
aagcttagaaatgttggcgtgatatgcgcggacccggtgtttcaagaaagtctttcaaaa
acgggtactgctccttttgacgcaaaacggtcatgcctgcttctgatggcgaaatacaga
atgattccgttcgtcgctatggcatcggctgtgtatcagcgggtgatcgagtacaaaatg
agaaacagagggtga

DBGET integrated database retrieval system