KEGG   Bacillus subtilis subsp. subtilis 168: BSU34310
Entry
BSU34310          CDS       T00010                                 

Symbol
epsG
Name
(RefSeq) transmembrane protein EpsG
  KO
K19419  transmembrane protein EpsG
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU34310 (epsG)
Transporters [BR:bsu02000]
 Other transporters
  Others
   BSU34310 (epsG)
SSDB
Motif
Pfam: EpsG
Other DBs
NCBI-GeneID: 937071
NCBI-ProteinID: NP_391311
Pasteur: BG11865
BSORF: BG11865
UniProt: P71056 A0A6M3ZJI5
Position
complement(3522170..3523273)
AA seq 367 aa
MIVYAVNMGIVFIWSWFAKMCGGRDDSLATGYRPNKLLIWIPLASLVLVSGLRYRVGTDF
QTYTLLYELAGDYQNVWQIFGFGTAKTATDPGFTALLWLMNFITEDPQIMYFTVAVVTYS
FIMKTLADYGRPFELSVFLFLGTFHYYASFNGIRQYMVAAVLFWAIRYIISGNWKRYFLI
VLVSSLFHSSALIMIPVYFIVRRKAWSPAIFGLSALFLGMTFLYQKFISVFVVVLENSSY
SHYEKWLMTNTNGMNVIKIAVLVLPLFLAFCYKERLRSLWPQIDIVVNLCLLGFLFGLLA
TKDVIFARFNIYFGLYQMILVPYFVRIFDEKSNALIYIAIVVCYFLYSYLLMPVDSSVLP
YRTIFSR
NT seq 1104 nt   +upstreamnt  +downstreamnt
atgattgtatatgccgtcaatatggggattgtatttatttggtcttggttcgctaaaatg
tgcggcggccgtgatgattcgcttgccacggggtatcggccgaataagcttttgatctgg
attccgctcgcttcacttgtgctcgtgtcaggtctccgctatcgagtcggcacggatttt
cagacgtacacgctgttgtacgaattggcgggcgattatcaaaatgtgtggcagatattc
ggtttcggcacagcgaaaacagcgacagatccggggtttaccgcactcctttggctgatg
aatttcatcacggaagatcctcaaatcatgtattttacggtggcggtcgtgacctacagc
tttattatgaagacactcgccgactatggcaggccgtttgagctgagtgtctttttattt
ttgggaacctttcattattacgcatcttttaacggcatcaggcaatacatggtggcagct
gttttgttttgggcgatccgttatatcattagcgggaactggaagcgatatttcctgatt
gtgctggtcagctcgctctttcattcgtcggcgctgattatgattccagtgtactttatt
gtcagaagaaaagcctggtcaccggcgatattcggcctatccgctttatttctcggcatg
acatttttatatcaaaaatttatttctgtgtttgtcgttgtacttgaaaacagctcatac
agccattatgaaaaatggctcatgacgaacacaaatggaatgaatgtgatcaaaatcgct
gttttggttctgccgctgttccttgcattttgctataaagaacgactgcggagtctgtgg
ccgcaaattgatattgtcgtcaatttgtgcctgctaggttttttgttcggccttttggcc
acaaaggacgtgatttttgccagattcaatatttatttcggtctgtatcaaatgatccta
gtcccttatttcgtcaggatatttgatgaaaaatcgaacgctcttatctatatcgctatc
gttgtttgttattttctttacagttatttgcttatgccggtcgattcatcggttctgcct
tacagaacgattttttcccggtaa

DBGET integrated database retrieval system