KEGG   Bacillus subtilis subsp. subtilis 168: BSU34320
Entry
BSU34320          CDS       T00010                                 

Symbol
epsF
Name
(RefSeq) glycosyltransferase EpsF
  KO
K19424  glycosyltransferase EpsF [EC:2.4.-.-]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:bsu01003]
    BSU34320 (epsF)
Enzymes [BR:bsu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.-  Glycosyltransferases
    2.4.-.-  
     BSU34320 (epsF)
Glycosyltransferases [BR:bsu01003]
 Polysaccharide
  Bacterial polysaccharide (excluding LPS)
   BSU34320 (epsF)
SSDB
Motif
Pfam: Glycos_transf_1 Glyco_transf_4 Glyco_trans_1_4 Glyco_trans_4_4 Glyco_trans_4_2
Other DBs
NCBI-GeneID: 938631
NCBI-ProteinID: NP_391312
Pasteur: BG11864
BSORF: BG11864
UniProt: P71055 A0A6M3ZGV2
Position
complement(3523270..3524424)
AA seq 384 aa
MNSSQKRVLHVLSGMNRGGAETMVMNLYRKMDKSKVQFDFLTYRNDPCAYDEEILSLGGR
LFYVPSIGQSNPLTFVRNVRNAIKENGPFSAVHAHTDFQTGFIALAARLAGVPVRVCHSH
NTSWKTGFNWKDRLQLLVFRRLILANATALCACGEDAGRFLFGQSNMERERVHLLPNGID
LELFAPNGQAADEEKAARGIAADRLIIGHVARFHEVKNHAFLLKLAAHLKERGIRFQLVL
AGDGPLCGEIEEEARQQNLLSDVLFLGTEERIHELMRTFDVFVMPSLYEGLPVVLVEAQA
SGLPCIISDSITEKVDAGLGLVTRLSLSEPISVWAETIARAAAAGRPKREFIKETLAQLG
YDAQQNVGALLNVYNISTEKDHNR
NT seq 1155 nt   +upstreamnt  +downstreamnt
atgaatagcagccaaaagcgcgtgctccatgttctcagcggcatgaacaggggcggcgcg
gaaaccatggtaatgaatttatatcggaagatggacaaaagcaaagtgcaatttgatttt
ttaacgtatcgaaatgatccgtgcgcttatgatgaagagattttatctttaggcgggcgg
cttttttatgtcccgagcattgggcaaagcaatccccttacatttgtgaggaatgtgaga
aacgcgataaaagaaaatgggccgttcagcgccgttcatgcgcacacggatttccaaacg
ggttttatcgcccttgcggcaaggctcgccggagtgccggtcagggtatgccactcccac
aatacgtcttggaagaccggcttcaactggaaggatcgattgcagctgctcgtgttcagg
cggctcattttggcaaatgcgacagcgctgtgtgcctgcggagaggatgcgggcaggttt
ttatttggacagtccaatatggagcgggagcgtgttcaccttcttcctaacgggattgac
cttgagttgttcgccccaaatgggcaggcggctgatgaagaaaaagcagcacgcggcatt
gcagccgaccggctcatcattggccatgtggcccggtttcatgaagtgaaaaaccacgcg
ttcctgttgaagcttgccgcacatctcaaggaaagaggcattcgctttcagctcgttctg
gcgggagacgggccgttgtgcggggagatagaggaggaggcgcggcagcagaatttgcta
tcagacgtcctctttttaggcacggaagaacggatccatgaactgatgcgaacattcgat
gtatttgtcatgccgtctctgtacgaaggcttgccggttgtgcttgtggaagcgcaggcg
tcggggcttccatgcatcatttcagacagcattacagaaaaagtcgacgccggtctcggg
cttgtcacaagattaagtctttctgagccgatcagcgtctgggctgaaaccattgcaagg
gcggccgccgcaggcaggccgaagcgtgagttcatcaaagaaacactcgctcaacttggc
tacgatgcacagcaaaatgtaggagcgctgctgaatgtatacaacatcagcacggaaaag
gaccataaccgatga

DBGET integrated database retrieval system