KEGG   Bacillus subtilis subsp. subtilis 168: BSU34330Help
Entry
BSU34330          CDS       T00010                                 

Gene name
epsE
Definition
(RefSeq) glycosyltransferase EpsE
  KO
K19423  glycosyltransferase EpsE [EC:2.4.-.-]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:bsu01003]
    BSU34330 (epsE)
Enzymes [BR:bsu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.-  Glycosyltransferases
    2.4.-.-  
     BSU34330 (epsE)
Glycosyltransferases [BR:bsu01003]
 Polysaccharide
  Bacterial polysaccharide
   BSU34330 (epsE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_2 Glyco_tranf_2_3 Glyco_tranf_2_2 Glyco_tranf_2_4 Glyco_transf_7C
Motif
Other DBs
NCBI-GeneID: 938633
NCBI-ProteinID: NP_391313
Pasteur: BG11863
BSORF: BG11863
UniProt: P71054
Position
complement(3524417..3525253)
Genome map
AA seq 278 aa AA seqDB search
MNSGPKVSVIMGIYNCERTLAESIESILSQSYKNWELILCDDASTDGTLRIAKQYAAHYS
DRIKLIQNKTNKRLAASLNHCLSHATGDYIARQDGDDLSFPRRLEKQVAFLEKHRHYQVV
GTGMLVFDEFGVRGARILPSVPEPGIMAKGTPFCHGTIMMRASAYRTLKGYRSVRRTRRM
EDIDLWLRFFEEGFRGYNLQEALYKVREDSDAFKRRSFTYSIDNAILVYQACRRLKLPLS
DYIYIAKPLIRAFMPAAVMNRYHKKRVMNQKEGLVKHE
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgaactcaggaccgaaagtttctgtcattatgggcatttataattgcgaacgcactttg
gcagaaagcatagaatccatactcagccaatcctataaaaattgggagctgattttgtgc
gatgatgcgtcaacagacggcacgctccgtatcgcgaagcagtatgccgctcattacagc
gaccgcatcaaactgattcaaaacaaaacaaataagcggcttgccgcatcattaaatcat
tgtctttcgcatgcgacaggcgattatatcgcacgtcaggacggagatgacctttcgttt
ccgcgccgtctggaaaagcaggtcgcgtttttagaaaagcaccgacactatcaggtggtt
ggcaccggcatgcttgtgtttgatgaatttggcgtaagaggcgcccgcattctgccttct
gttccggagccgggcatcatggcaaaagggactccattttgccacggcacgattatgatg
agagcgagtgcctaccgcacgctgaaaggctaccggtcggtgcggcggacgagacgaatg
gaagatattgatttgtggcttcgcttttttgaagagggcttcaggggctataatcttcag
gaagccttgtataaagtgagggaagacagcgatgcattcaaacggcggtcatttacgtat
tcaatcgacaatgccattcttgtctatcaggcgtgcagacgcttgaagcttcctttatct
gattacatatatatcgcaaaaccgttaattcgcgcctttatgcctgcagctgtgatgaat
cgctaccataaaaaaagagtgatgaaccaaaaggaagggcttgtcaagcatgaatag

DBGET integrated database retrieval system