KEGG   Bacillus subtilis subsp. subtilis 168: BSU34340
Entry
BSU34340          CDS       T00010                                 

Symbol
epsD
Name
(RefSeq) glycosyltransferase EpsD
  KO
K19422  glycosyltransferase EpsD [EC:2.4.-.-]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BSU34340 (epsD)
Enzymes [BR:bsu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.-  Glycosyltransferases
    2.4.-.-  
     BSU34340 (epsD)
SSDB
Motif
Pfam: Glycos_transf_1 Glyco_trans_1_4 Glyco_transf_4 Glyco_trans_4_2 Glyco_trans_4_4 Glyco_trans_1_2 PIGA DUF4224
Other DBs
NCBI-GeneID: 938611
NCBI-ProteinID: NP_391314
Pasteur: BG11862
BSORF: BG11862
UniProt: P71053 A0A6M3ZH71
Position
complement(3525250..3526395)
AA seq 381 aa
MTKKILFCATVDYHFKAFHLPYFKWFKQMGWEVHVAANGQTKLPYVDEKFSIPIRRSPFD
PQNLAVYRQLKKVIDTYEYDIVHCHTPVGGVLARLAARQARRHGTKVLYTAHGFHFCKGA
PMKNWLLYYPVEKWLSAYTDCLITINEEDYIRAKGLQRPGGRTQKIHGIGVNTERFRPVS
PIEQQRLREKHGFREDDFILVYPAELNLNKNQKQLIEAAALLKEKIPSLRLVFAGEGAME
HTYQTLAEKLGASAHVCFYGFCSDIHELIQLADVSVASSIREGLGMNVLEGMAAEQPAIA
TDNRGHREIIRDGENGFLIKIGDSAAFARRIEQLYHKPELCRKLGQEGRKTALRFSEART
VEEMADIYSAYMDMDTKEKSV
NT seq 1146 nt   +upstreamnt  +downstreamnt
atgacgaaaaagatattgttttgcgcgactgttgattatcattttaaggcctttcacctc
ccttattttaaatggttcaagcaaatgggctgggaggttcatgtcgccgcgaacggacaa
accaagctgccgtatgtggatgagaaattctccatcccgattcgcaggtcaccttttgac
cctcagaacctggccgtttataggcagctgaagaaagtgattgacacttatgaatacgac
attgtccattgccatacaccggtcggcggcgttctcgccagactggcggcgaggcaggca
cggcggcacggaacaaaggtgctgtacacagcgcacggatttcacttctgcaaaggggca
ccgatgaaaaattggcttctttactatccggttgagaaatggctttcagcatatacagac
tgcctgattacgattaatgaagaggattacatacgggcgaaaggacttcaaaggccgggc
ggaaggacgcagaaaattcacggcattggcgtcaataccgagcgtttccggcctgtcagt
ccgatagagcagcaaagactcagagaaaagcacgggttccgtgaagatgattttatattg
gtttatccggctgagctcaatctgaacaaaaaccagaagcagttaattgaagccgcagcc
ttgctaaaagaaaaaattccctcactccgccttgtgtttgccggggaaggggcaatggaa
catacgtatcaaacgttagctgaaaagcttggtgcctccgcccatgtctgtttttacggc
ttttgcagcgacatacatgagttgattcagcttgcggatgtatctgtcgcatccagcatt
agagaaggcctcggtatgaatgtgcttgagggaatggcggcagaacaaccggcgatcgcc
acagataatcgcgggcatcgggaaatcatccgcgacggagaaaacggttttctgatcaaa
atcggtgacagtgctgcttttgcccgccggattgaacagctttaccataagccggagctc
tgccgaaagctgggacaggaaggccgaaaaacagccttgcgcttctcggaggcgcgaacg
gtggaagaaatggcagatatttattccgcgtacatggatatggatacaaaggagaaaagc
gtatga

DBGET integrated database retrieval system