KEGG   Bacillus subtilis subsp. subtilis 168: BSU34350
Entry
BSU34350          CDS       T00010                                 

Symbol
epsC
Name
(RefSeq) polysaccharide biosynthesis protein EpsC
  KO
K19421  polysaccharide biosynthesis protein EpsC
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99986 Glycan metabolism
    BSU34350 (epsC)
SSDB
Motif
Pfam: Polysacc_synt_2 Epimerase GDP_Man_Dehyd RmlD_sub_bind CoA_binding_3 3Beta_HSD KR adh_short Shikimate_DH PglD_N NAD_binding_4 NAD_binding_10 Sacchrp_dh_NADP DUF3842
Other DBs
NCBI-GeneID: 938571
NCBI-ProteinID: NP_391315
Pasteur: BG11861
BSORF: BG11861
UniProt: P71052 A0A6M3ZIZ9
Position
complement(3526407..3528203)
AA seq 598 aa
MIIALDTYLVLNSVIAGYQFLKDSYQFYDSGALLLTAVSLLLSYHVCAFLFNQYKQVWTY
TGLGELIVLLKGITLSAAVTGVIQYAVYHTMFFRLLTACWVLQLLSIGGTRILSRVLNES
IRKKRCASSRALIIGAGSGGTLMVRQLLSKDEPDIIPVAFIDDDQTKHKLEIMGLPVIGG
KESIMPAVQKLKINYIIIAIPSLRTHELQVLYKECVRTGVSIKIMPHFDEMLLGTRTAGQ
IRDVKAEDLLGRKPVTLDTSEISNRIKGKTVLVTGAGGSIGSEICRQISAFQPKEIILLG
HGENSIHSIYTELNGRFGKHIVFHTEIADVQDRDKMFTLMKKYEPHVVYHAAAHKHVPLM
EHNPEEAVKNNIIGTKNVAEAADMSGTETFVLISSDKAVNPANVMGATKRFAEMIIMNLG
KVSRTKFVAVRFGNVLGSRGSVIPIFKKQIEKGGPVTVTHPAMTRYFMTIPEASRLVIQA
GALAKGRQIFVLDMGEPVKIVDLAKNLIHLSGYTTEQVPIEFTGIRPGEKMYEELLNKNE
VHAEQIFPKIHIGKAVDGDWPVLMRFIEDFHELPEADLRARLFAAINTSEEMTAASVH
NT seq 1797 nt   +upstreamnt  +downstreamnt
atgattattgcgctggatacttacctcgttttaaattcagttattgcaggatatcaattt
ttaaaagattcctatcaattttatgactccggagcattactgcttaccgctgtcagcttg
ctcctcagctatcatgtgtgtgctttcctgttcaatcagtataaacaggtgtggacatac
accgggcttggcgagctgattgtcctgcttaagggcattacgctttcagccgctgtgacc
ggcgtcattcagtatgctgtgtatcacacgatgttcttccgtctgttaaccgcgtgctgg
gtgcttcagcttttgtctattggagggacccgtattttatccagagtattaaacgaaagc
atcaggaaaaaacgctgcgcctcgtcccgcgcgctgattatcggggcgggctcaggtggg
actctgatggtcaggcagctgctttcgaaagatgaacctgatatcatacctgtcgctttt
attgatgacgaccaaacgaagcataaattagaaattatggggctgcccgtaatcggcgga
aaagaaagtatcatgcctgcggtgcaaaagctcaaaattaattatattattattgccatt
ccttcactccgcacccatgagcttcaggtgttatataaagaatgtgtgcgaaccggagta
agcattaaaattatgcctcattttgatgaaatgctgcttggcacacgaactgccggacaa
atcagagatgtaaaagctgaggacttgctcggcagaaagccggtaaccctcgacactagc
gaaatttcgaaccgcatcaaaggaaaaacagttctcgtcacgggagcgggcggatcaatc
ggctcggaaatctgccgtcagatcagcgcgtttcagcctaaggaaatcattctgctcggc
catggggaaaacagcattcattcgatttatacagagctgaacggacgattcggcaaacac
attgtgttccatacggaaatcgctgatgtgcaggaccgcgataaaatgtttaccttgatg
aaaaaatacgagccgcatgttgtctatcatgcagctgcccataagcatgtgcctttaatg
gaacacaatccagaagaggcggtcaaaaacaatattatcggaacaaaaaatgtcgcggaa
gcagccgatatgtcgggaactgagacattcgtgctgatttcatcggacaaagcggtgaac
ccagccaacgtaatgggggcgacaaaacgattcgcagagatgattattatgaatcttggg
aaagtcagcagaaccaaatttgttgctgttcgcttcggcaatgtactcgggagccgcggc
agcgtcattccaattttcaaaaaacagattgaaaaaggcggcccggtgacagtaacacat
ccggcaatgacccgctatttcatgacgattcccgaggcatcaaggcttgtgattcaggct
ggggcactggcgaaagggcgtcaaattttcgttctcgatatgggagagcccgtaaagatt
gtggatcttgccaaaaacctcattcatttgtccggctacacgactgagcaggttccaatc
gaattcacaggcattcgtccgggcgaaaaaatgtatgaagaattgctgaacaaaaatgaa
gtccatgctgaacaaatctttccaaaaattcacatcggtaaagcggtggacggcgattgg
ccggtgctgatgcgctttatcgaggattttcatgagctgccggaagccgacctgagagcg
aggctgtttgcggcaatcaatacatcagaagaaatgacggctgccagcgttcattag

DBGET integrated database retrieval system