KEGG   Bacillus subtilis subsp. subtilis 168: BSU34360
Entry
BSU34360          CDS       T00010                                 

Symbol
epsB
Name
(RefSeq) tyrosine-protein kinase YveL
  KO
K00903  protein-tyrosine kinase [EC:2.7.10.2]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bsu01001]
    BSU34360 (epsB)
Enzymes [BR:bsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     BSU34360 (epsB)
Protein kinases [BR:bsu01001]
 Non-receptor tyrosine kinases
  Bacterial
   BSU34360 (epsB)
SSDB
Motif
Pfam: AAA_31 ParA CbiA Ketoacyl-synt_2 SRP54 HEM4 Fer4_NifH
Other DBs
NCBI-GeneID: 938640
NCBI-ProteinID: NP_391316
Pasteur: BG11860
BSORF: BG11860
UniProt: P71051
Position
complement(3528462..3529145)
AA seq 227 aa
MIFRKKKARRGLAQISVLHNKSVVAEQYRTIRTNIEFSSVQTNLRSILVTSSVPGEGKSF
SAANLAAVFAQQQEKKVLLVDADLRKPTINQTFQVDNVTGLTNVLVGNASLSETVQKTPI
DNLYVLTSGPTPPNPAELLSSKAMGDLISEIYEQFSLVIFDSPPLLAVADAQILANQTDG
SVLVVLSGKTKTDTVLKAKDALEQSNAKLLGALLNKKKMKKSEHYSY
NT seq 684 nt   +upstreamnt  +downstreamnt
gtgatctttagaaaaaagaaagcaaggcgaggtttggctcaaatatctgttttacacaat
aaatcagttgttgcggaacaatatcgcaccattcggacaaacattgagttctcatctgtc
cagaccaacttgcgatctatcctcgtcacctcctctgtgcctggtgaaggtaaatcgttc
agtgcagcgaatcttgcggctgtctttgcgcagcagcaggaaaagaaagtactgctggtg
gatgccgatttaagaaagccgaccatcaatcagacgtttcaggttgataatgtaaccggg
ctgacaaatgtgctggtcggcaatgcttcactcagtgagacggtgcaaaagacgccgatc
gataacttatatgtactgacaagcgggccgaccccgccaaacccggcagaactgttgtct
tcaaaagcaatgggagatttaatatctgagatctatgaacaattcagcctcgtcatcttt
gattcccctcctcttttggctgttgcagatgctcagattctagcaaatcagacagacggc
agcgtgctcgtcgttttaagcggaaaaacaaaaaccgataccgttctgaaagcaaaagat
gcactggaacaatccaatgcgaagctgttaggcgctcttttaaacaaaaagaaaatgaaa
aaatcggaacactattcctactag

DBGET integrated database retrieval system