KEGG   Bacillus subtilis subsp. subtilis 168: BSU34370
Entry
BSU34370          CDS       T00010                                 

Symbol
epsA
Name
(RefSeq) hypothetical protein
  KO
K19420  protein tyrosine kinase EpsB modulator
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99986 Glycan metabolism
    BSU34370 (epsA)
SSDB
Motif
Pfam: Wzz GNVR
Other DBs
NCBI-GeneID: 938582
NCBI-ProteinID: NP_391317
Pasteur: BG11859
BSORF: BG11859
UniProt: P71050 A0A6M3ZG81
Position
complement(3529151..3529855)
AA seq 234 aa
MNENMSFKELYAIVRHRFVLILLITIGVTLIMGFVQFKVISPTYQASTQVLVHESDGEEN
SNLSDIQRNLQYSSTFQSIMKSTALMEEVKAELHLSESASSLKGKVVTSSENESEIINVA
VQDHDPAKAAEIANTLVNKFEKEVDERMNVQGVHILSEAKASESPMIKPARLRNMVMAFG
AAVMGGITLAFFLHFLDDTCKSARQLSERTGLPCLGSVPDVHKGRNRGIKHFGE
NT seq 705 nt   +upstreamnt  +downstreamnt
atgaatgagaatatgagtttcaaagaattatatgcgattgtcagacacagattcgtgctg
attctgctcatcacaatcggcgtcacccttattatgggttttgtgcaatttaaggtcatt
tcaccgacctaccaggcgtcgacacaggtgctggttcatgaatcagacggtgaagaaaac
tcgaatctcagtgacatccagcgaaatcttcagtatagcagcacgttccaatcgattatg
aaaagcactgccttgatggaagaagttaaggcggaattgcacctatctgaatcggcttcc
tcgctgaaaggaaaagtggttaccagcagtgaaaatgaatcagaaataatcaacgttgcc
gttcaggatcacgatccggcgaaagcagctgagattgcgaacacgttagtgaacaagttt
gaaaaagaagtagatgaaagaatgaatgtacaaggcgtacatatattatcagaggcgaag
gcttcggaaagcccgatgatcaagccggccaggctgcgaaatatggtcatggcttttggc
gctgctgtcatgggcggcattacactggcattttttctgcattttctcgatgatacatgc
aaaagcgcacggcagctcagcgagagaaccggattgccatgcttaggctccgttcctgat
gtccacaaagggcggaatcgcgggataaaacatttcggggagtga

DBGET integrated database retrieval system