KEGG   Bacillus subtilis subsp. subtilis 168: BSU34410
Entry
BSU34410          CDS       T00010                                 

Symbol
yveG
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF3237
Other DBs
NCBI-GeneID: 938578
NCBI-ProteinID: NP_391321
Pasteur: BG12432
BSORF: BG12432
Position
complement(3532833..3533120)
AA seq 95 aa
MIRANGRTDLSARYVIETADHELIYIENNGIRQVSKPFRKQAAAGEIIEPEHVYFRTVPT
FETGSEVYQWLHDRLFIGSAERTPDYVLLDIYEVQ
NT seq 288 nt   +upstreamnt  +downstreamnt
atgattcgcgctaacggcagaacagatttatctgccaggtatgtgattgaaacagcagat
catgaactgatttacattgaaaacaatggaatacggcaagtcagcaagccgtttcgaaaa
caagcggcagccggggaaattattgaaccggagcatgtttattttcgtacggtaccgacg
tttgaaacaggcagtgaagtctatcaatggctccatgaccgcttgtttatcggttccgca
gaaagaacccctgattacgttctactagacatttatgaagtacagtaa

DBGET integrated database retrieval system