KEGG   Bacillus subtilis subsp. subtilis 168: BSU34420
Entry
BSU34420          CDS       T00010                                 

Symbol
yveF
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF3237
Other DBs
NCBI-GeneID: 938614
NCBI-ProteinID: NP_391322
Pasteur: BG12431
BSORF: BG12431
UniProt: O07004
Position
complement(3533196..3533288)
AA seq 30 aa
MKKPVLKPFASLEIKVDPPITIGETSLGLR
NT seq 93 nt   +upstreamnt  +downstreamnt
gtgaagaagccggttttaaaaccattcgcctctttagaaatcaaggttgatccgcctatc
acgattggtgagacaagcctgggactgagatga

DBGET integrated database retrieval system