KEGG   Bacillus subtilis subsp. subtilis 168: BSU34430Help
Entry
BSU34430          CDS       T00010                                 

Gene name
racX
Definition
(RefSeq) amino acid racemase
  KO
K01779  aspartate racemase [EC:5.1.1.13]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00250  Alanine, aspartate and glutamate metabolism
bsu01054  Nonribosomal peptide structures
bsu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BSU34430 (racX)
  09109 Metabolism of terpenoids and polyketides
   01054 Nonribosomal peptide structures
    BSU34430 (racX)
Enzymes [BR:bsu01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.13  aspartate racemase
     BSU34430 (racX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asp_Glu_race SATase_N Haem_oxygenas_2 NodZ
Motif
Other DBs
NCBI-GeneID: 938575
NCBI-ProteinID: NP_391323
Pasteur: BG10391
BSORF: BG10391
UniProt: P32960
Position
complement(3533419..3534102)
Genome map
AA seq 227 aa AA seqDB search
MIGILAGMGPKSTSPFIDKVIDYCQKLYGASNDIDYPHMMIYSCPTPFYADRPIDHDEMK
KAIIDGAVKLEKTGVDFIALPCNTAHVYYEEIQQALSVPMLHIVEETIKEIPHPAKKAVV
LGTEPTIQSAIYQKVLKGNGQEVIHKDHWQQAVNQLIAAIKQPNHMQHTQALWQTLYEEI
SQHADIIISACTDLNAVLDHIQSEIPIIDSSACLAKSTVSTYLAYQS
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atgatcggaatattagccggaatggggccgaaatcgacctcgccgtttattgataaggtg
attgattactgtcagaagctgtatggggcttcaaacgatattgactatccgcacatgatg
atctattcatgcccgacgcccttctatgcagatcgtccaattgaccatgacgagatgaaa
aaagcgattatcgacggagcggtaaagctcgagaaaacaggcgtggatttcattgcgctg
ccttgtaatacggcgcatgtctactatgaagagattcagcaggcattgtcagttcctatg
ttgcatattgttgaggaaacgataaaagagattccgcatcccgcaaaaaaagcggtggtt
ttaggaacagagccaaccatccaatccgccatctaccaaaaagttctgaagggaaatgga
caagaagttattcacaaggaccattggcagcaggctgtgaaccagcttatcgccgcaatc
aaacagccaaatcatatgcagcatacacaagcattgtggcagacgctatatgaagaaatc
agtcagcatgcagacatcatcatttcagcctgcacggatttaaatgcggtgttagatcat
attcaaagtgagattccgattatagattcctctgcctgtcttgccaaaagcactgtcagc
acatatcttgcttatcaaagctag

DBGET integrated database retrieval system