KEGG   Bacillus subtilis subsp. subtilis 168: BSU34430
Entry
BSU34430          CDS       T00010                                 

Symbol
racX
Name
(RefSeq) amino acid racemase
  KO
K25316  amino-acid racemase [EC:5.1.1.10]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00260  Glycine, serine and threonine metabolism
bsu00270  Cysteine and methionine metabolism
bsu00310  Lysine degradation
bsu00470  D-Amino acid metabolism
bsu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BSU34430 (racX)
   00270 Cysteine and methionine metabolism
    BSU34430 (racX)
   00310 Lysine degradation
    BSU34430 (racX)
  09106 Metabolism of other amino acids
   00470 D-Amino acid metabolism
    BSU34430 (racX)
Enzymes [BR:bsu01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.10  amino-acid racemase
     BSU34430 (racX)
SSDB
Motif
Pfam: Asp_Glu_race SATase_N Ferritin_2 ARID
Other DBs
NCBI-GeneID: 938575
NCBI-ProteinID: NP_391323
Pasteur: BG10391
BSORF: BG10391
UniProt: P32960 A0A6M3ZGH8
Position
complement(3533419..3534102)
AA seq 227 aa
MIGILAGMGPKSTSPFIDKVIDYCQKLYGASNDIDYPHMMIYSCPTPFYADRPIDHDEMK
KAIIDGAVKLEKTGVDFIALPCNTAHVYYEEIQQALSVPMLHIVEETIKEIPHPAKKAVV
LGTEPTIQSAIYQKVLKGNGQEVIHKDHWQQAVNQLIAAIKQPNHMQHTQALWQTLYEEI
SQHADIIISACTDLNAVLDHIQSEIPIIDSSACLAKSTVSTYLAYQS
NT seq 684 nt   +upstreamnt  +downstreamnt
atgatcggaatattagccggaatggggccgaaatcgacctcgccgtttattgataaggtg
attgattactgtcagaagctgtatggggcttcaaacgatattgactatccgcacatgatg
atctattcatgcccgacgcccttctatgcagatcgtccaattgaccatgacgagatgaaa
aaagcgattatcgacggagcggtaaagctcgagaaaacaggcgtggatttcattgcgctg
ccttgtaatacggcgcatgtctactatgaagagattcagcaggcattgtcagttcctatg
ttgcatattgttgaggaaacgataaaagagattccgcatcccgcaaaaaaagcggtggtt
ttaggaacagagccaaccatccaatccgccatctaccaaaaagttctgaagggaaatgga
caagaagttattcacaaggaccattggcagcaggctgtgaaccagcttatcgccgcaatc
aaacagccaaatcatatgcagcatacacaagcattgtggcagacgctatatgaagaaatc
agtcagcatgcagacatcatcatttcagcctgcacggatttaaatgcggtgttagatcat
attcaaagtgagattccgattatagattcctctgcctgtcttgccaaaagcactgtcagc
acatatcttgcttatcaaagctag

DBGET integrated database retrieval system