KEGG   Bacillus subtilis subsp. subtilis 168: BSU34440
Entry
BSU34440          CDS       T00010                                 

Symbol
pbpE
Name
(RefSeq) penicillin-binding protein 4
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Beta-lactamase DUF3471
Other DBs
NCBI-GeneID: 938615
NCBI-ProteinID: NP_391324
Pasteur: BG10390
BSORF: BG10390
UniProt: P32959 A0A6M3ZJJ2
Position
complement(3534118..3535473)
AA seq 451 aa
MKQNKRKHLQTLFETLGEKHQFNGTVLAAEGGDILYHHSFGYAEMTEKRPLKTNSLFELA
SLSKPFTALGIILLEEKGILGYEDKVDRWLPGFPYQGVTIRHLLNHTSGLPDYMGWFFAN
WDSHKIAVNQDIVDMLMNEGLSGYFEPNEGWMYSNTGYVLLAVIIEKASGMSYADFIKTS
IFLPAGMNETRVYNRRLSPERIDHYAYGYVYDVHSETYVLPDELEETNYVVYLDGIQGDG
TVNSVTSDLFRFDQALYQDDFISKASKESAFSPVRLNNGETIDYGFGWVLQNSPEKGRIV
SHSGGWPGYSTMMIRYIDHRKTLIYLSNKEEDTEYEQAILKAAEHILFGQPYDVPERPAD
KKKKAIDTAIYSRYVGSYLLQDGTAAQVTTENERLYLEIAGQLRLELFPSSETRFFLRAL
SVEVEFTLGEDAAKSFILYEDGSEEEAVRTK
NT seq 1356 nt   +upstreamnt  +downstreamnt
atgaagcagaataaaagaaagcatcttcagacgttatttgagacattaggcgaaaaacat
cagtttaacgggacggttctggctgcggagggtggcgatattttatatcaccactctttt
ggctatgcggaaatgacggaaaaacgcccgttgaaaaccaactctttgtttgagttagcg
tctttgtcaaagccttttacagcattgggaatcatcttgctggaggagaaggggattctt
ggctatgaggataaagtggatcgctggctgcccggttttccgtatcagggcgtaacgatt
cggcatttattgaaccatacgtcagggcttcctgattatatgggatggttttttgccaat
tgggattcacacaagattgcggtgaatcaggatattgtcgatatgctgatgaatgagggg
ctatctggttattttgaaccgaatgaaggctggatgtacagcaatacggggtatgtgctg
ctggcggttatcattgaaaaagcatctggcatgagctatgcggattttataaaaacaagt
atttttttaccggcaggcatgaatgaaacaagagtgtataacaggaggctttcgcctgag
cgaattgatcattatgcatatggatatgtgtatgatgtacattccgaaacatacgtcctc
cctgatgagctggaggaaacgaactatgttgtgtatctcgatggcatacagggagatggg
acggttaactctgtcacaagcgatttgtttcgatttgatcaggctttatatcaggacgat
ttcatcagcaaggcttctaaggaatctgcgttttctccagtgcgcctcaacaatggagaa
acaattgattatggctttggctgggtgctgcaaaacagtcctgaaaaagggcggattgtc
agccacagcggaggatggcccggctattcgacgatgatgatccgatatatcgatcatcgt
aaaacgctgatctatttgagtaataaggaagaggatactgaatatgaacaagcgattctg
aaggcggcggaacatattctatttggccagccatatgatgtcccggaacgtcctgctgat
aaaaagaaaaaagcaattgatacggcgatatacagccgctatgttggcagctacctgttg
caggatgggacggctgcacaggtgacaaccgagaatgaacggctttatttggagatcgcc
ggacagctgagactggagttatttccttcctcggaaacccgtttctttctgcgagcattg
tctgttgaagtcgagtttacattaggtgaggatgctgcgaaaagctttatcctctatgag
gatggctcagaggaagaagcggtccgtacgaagtag

DBGET integrated database retrieval system