KEGG   Bacillus subtilis subsp. subtilis 168: BSU34470Help
Entry
BSU34470          CDS       T00010                                 

Gene name
yveA
Definition
(RefSeq) aspartate-proton symporter
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_permease_2 AA_permease Spore_permease
Motif
Other DBs
NCBI-GeneID: 938612
NCBI-ProteinID: NP_391327
Pasteur: BG12429
BSORF: BG12429
UniProt: O07002
Position
3539165..3540727
Genome map
AA seq 520 aa AA seqDB search
MSKQGNFQKSMSLFDLILIGMGAIFGSAWLFAVSNVASKAGPSGAFSWILGGAIILLIGL
VYAELGAALPRTGGIIRYPVYSHGHLVGYLISFVTIVAYTSLISIEVTAVRQYVAYWFPG
LTIKGSDSPTISGWILQFALLCLFFLLNYWSVKTFAKANFIISIFKYIVPITIIIVLIFH
FQPENLSVQGFAPFGFTGIQAAISTGGVMFAYLGLHPIVSVAGEVQNPKRNIPIALIICI
IVSTIIYTVLQVTFIGAIPTETLKHGWPAIGREFSLPFKDIAVMLGLGWLATLVILDAIL
SPGGNGNIFMNTTSRLVYAWARNGTLFGIFSKVNKDTGTPRASLWLSFALSIFWTLPFPS
WNALVNVCSVALILSYAIAPISSAALRVNAKDLNRPFYLKGMSIIGPLSFIFTAFIVYWS
GWKTVSWLLGSQLVMFLIYLCFSKYTPKEDVSLAQQLKSAWWLIGFYIMMLIFSYIGSFG
HGLGIISNPVDLILVAIGSLAIYYWAKYTGLPKAAIDYDK
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaacaaggaaattttcaaaaatcaatgtcgctgtttgatctgattttgattggg
atgggagccatctttggatcagcgtggctgttcgctgtcagtaatgtcgcttcaaaagca
gggccctccggcgctttttcctggatcctcggaggagccattattttgttaatcgggctt
gtatatgcggagctcggagccgctctgccccgtaccggaggcatcattcgataccccgtt
tattcacatggccaccttgtcggctacttaatttcgtttgtcacgattgtcgcttataca
agcttgatttcaattgaagtgacagctgtgcgccagtatgtggcctattggtttcccggc
ctgaccattaaagggtctgattcgcctaccatttccggctggatcttgcagtttgcccta
ttatgcttgtttttcctgctgaattattggagcgtcaaaaccttcgctaaggcgaatttc
atcatatcgatttttaaatatattgtgccgattaccatcattattgtgctgatctttcat
tttcagccggagaatttatccgttcaaggatttgcaccgtttggatttacaggtattcag
gctgccatctcgacaggcggcgtcatgtttgcgtatctcggcctgcatccgattgtatct
gtagcaggtgaagtccaaaatccaaaacgcaatatcccgatcgctttaatcatttgcatc
atcgtttcaaccatcatttatactgttttgcaggtcacctttattggtgcaatcccgaca
gaaacactgaaacatggctggccggcaattggccgggagttctcattgccgtttaaggat
attgcggtcatgctcgggttaggctggcttgcaacgcttgtcattttagacgccattctg
tctcccggaggaaacgggaatatctttatgaatacgacatcccgccttgtttacgcctgg
gcgcgtaacggcacattatttggcatattctcaaaggtcaataaagatacggggacaccc
cgcgcttcgctttggctttcgtttgccctgtccattttctggacacttccctttccttcg
tggaacgcgctcgtcaatgtctgttcagtcgcgctcattctttcatatgcgattgcaccc
atttcttcagctgcgctgagggtcaacgcgaaggacttaaacaggccgttttatttaaag
ggaatgagcattatcgggccgctttcctttatatttacagcgtttatcgtgtactggtca
ggatggaaaacagtctcctggctgctcggttcacaactcgtgatgtttttgatctatctc
tgtttcagcaaatatacgcctaaagaagatgtcagccttgctcagcagctgaaatcagcc
tggtggcttatcgggttttatattatgatgctgatcttttcctacatcggttctttcgga
catggtttagggattatcagcaatcccgtcgacctcattttagtcgcgatcggctcactt
gcgatttattactgggcaaagtataccgggctcccaaaagccgccattgattatgataaa
taa

DBGET integrated database retrieval system