KEGG   Bacillus subtilis subsp. subtilis 168: BSU34480Help
Entry
BSU34480          CDS       T00010                                 

Gene name
yvdT
Definition
(RefSeq) HTH-type transcriptional regulator YvdT
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TetR_C_26 TetR_N RB_B TetR_C_4
Motif
Other DBs
NCBI-GeneID: 936423
NCBI-ProteinID: NP_391328
Pasteur: BG12428
BSORF: BG12428
UniProt: O07001
Structure
PDB: 

Position
3540822..3541406
Genome map
AA seq 194 aa AA seqDB search
MPKQTSGKYEKILQAAIEVISEKGLDKASISDIVKKAGTAQGTFYLYFSSKNALIPAIAE
NLLTHTLDQIKGRLHGDEDFWTVLDILIDETFLITERHKDIIVLCYSGLAIDHSMEKWET
IYQPYYSWLEKIINKAIANHEVTEGINSKWTARTIINLVENTAERFYIGFEQDENVEVYK
KEIFTFLKRSLGTA
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgccaaaacaaacatcgggtaaatacgaaaaaatattgcaggcggccatagaagtcatt
tctgaaaaaggcctcgacaaagcttctatttctgatattgtcaaaaaggccggcactgcc
caaggaacattctatttgtatttttcatctaaaaatgccctcataccggccattgcagaa
aatctcctcacccatacacttgatcaaatcaaaggtaggctccatggggacgaggatttt
tggaccgttttagatatattaattgatgagacatttctcattacagaacgccataaggat
attattgtcctctgttattccgggcttgcgatcgaccactccatggaaaaatgggagacg
atctatcagccttattattcctggcttgaaaaaatcatcaacaaggccattgcaaaccat
gaggtaacggaaggaatcaattcaaaatggacggccagaacgattatcaacttggtcgag
aatactgcggaacgattctatatcggatttgaacaagatgaaaatgttgaagtgtataaa
aaggaaattttcactttcttaaaacggagcttaggtactgcttaa

DBGET integrated database retrieval system