KEGG   Bacillus subtilis subsp. subtilis 168: BSU34490
Entry
BSU34490          CDS       T00010                                 

Symbol
yvdS
Name
(RefSeq) hypothetical protein
  KO
K18924  paired small multidrug resistance pump
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU34490 (yvdS)
Transporters [BR:bsu02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   BSU34490 (yvdS)
SSDB
Motif
Pfam: Multi_Drug_Res DUF6185 7TM-7TMR_HD YfhO Phage_holin_5_1
Other DBs
NCBI-GeneID: 936401
NCBI-ProteinID: NP_391329
Pasteur: BG12427
BSORF: BG12427
UniProt: O32262 A0A6M3ZG92
Position
3541488..3541823
AA seq 111 aa
MNWVLVFIAGLLEVVWASSLKHADSLLDWIIIFILIAVSFILLIRSYQKIPMAAAYTVFV
GIGTVGTYLTGIVLGESFSAAQMFFLALLLAGILGMKLFTKESKSQPGGEK
NT seq 336 nt   +upstreamnt  +downstreamnt
ttgaattgggttcttgtttttattgcagggcttttagaggttgtttgggcctcttccctc
aaacatgccgattcgcttttggattggatcatcatttttatcttaatcgcggtcagcttt
atcctgttgatccgctcttatcaaaaaatcccgatggccgcggcgtacactgtgtttgtg
ggaatcggaaccgtcggaacatatctgactggaattgttctgggcgaatccttctcagca
gcccaaatgttctttttagctttattgctggctggcattttaggaatgaaattatttacg
aaagaaagcaaatctcagccgggaggtgaaaaataa

DBGET integrated database retrieval system