KEGG   Bacillus subtilis subsp. subtilis 168: BSU34490Help
Entry
BSU34490          CDS       T00010                                 

Gene name
yvdS
Definition
(RefSeq) hypothetical protein
  KO
K18924  paired small multidrug resistance pump
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Module
bsu_M00712  Multidrug resistance, efflux pump YkkCD
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU34490 (yvdS)
Transporters [BR:bsu02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   BSU34490 (yvdS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Multi_Drug_Res Phage_holin_5_1 PHO4
Motif
Other DBs
NCBI-GeneID: 936401
NCBI-ProteinID: NP_391329
Pasteur: BG12427
BSORF: BG12427
UniProt: O32262
Position
3541488..3541823
Genome map
AA seq 111 aa AA seqDB search
MNWVLVFIAGLLEVVWASSLKHADSLLDWIIIFILIAVSFILLIRSYQKIPMAAAYTVFV
GIGTVGTYLTGIVLGESFSAAQMFFLALLLAGILGMKLFTKESKSQPGGEK
NT seq 336 nt NT seq  +upstreamnt  +downstreamnt
ttgaattgggttcttgtttttattgcagggcttttagaggttgtttgggcctcttccctc
aaacatgccgattcgcttttggattggatcatcatttttatcttaatcgcggtcagcttt
atcctgttgatccgctcttatcaaaaaatcccgatggccgcggcgtacactgtgtttgtg
ggaatcggaaccgtcggaacatatctgactggaattgttctgggcgaatccttctcagca
gcccaaatgttctttttagctttattgctggctggcattttaggaatgaaattatttacg
aaagaaagcaaatctcagccgggaggtgaaaaataa

DBGET integrated database retrieval system