KEGG   Bacillus subtilis subsp. subtilis 168: BSU34500Help
Entry
BSU34500          CDS       T00010                                 

Gene name
yvdR
Definition
(RefSeq) hypothetical protein
  KO
K11741  quaternary ammonium compound-resistance protein SugE
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU34500 (yvdR)
Transporters [BR:bsu02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   BSU34500 (yvdR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Multi_Drug_Res EamA
Motif
Other DBs
NCBI-GeneID: 938613
NCBI-ProteinID: NP_391330
Pasteur: BG12426
BSORF: BG12426
UniProt: O06999
Position
3541823..3542143
Genome map
AA seq 106 aa AA seqDB search
MAWFLLVIAGIEEIIAAIAMKYIDGTRKKWPIIVMTVGFGLSFYCLSQAMIVLPAGVAYA
VWTGIGSIGVSAVGLIWFKERFQLSQVISLCLILAGVIGLRLTSSS
NT seq 321 nt NT seq  +upstreamnt  +downstreamnt
atggcatggtttttattagtgattgccggcatagaagaaattatagctgccattgccatg
aaatatatagacggaacaagaaaaaaatggccgatcattgtgatgactgttggattcggc
ttatccttttactgcctgtcccaagcgatgatcgtcctgcctgccggagtcgcatatgcc
gtctggactggcattggaagcattggtgtttcggcggtcgggctcatctggtttaaggag
cggtttcagctttcacaggtgatttcactttgccttatcctagccggcgtcatcggcctg
cgtcttacgtcatcttcataa

DBGET integrated database retrieval system