KEGG   Bacillus subtilis subsp. subtilis 168: BSU34510Help
Entry
BSU34510          CDS       T00010                                 

Gene name
yvdQ
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3231 Coat_F
Motif
Other DBs
NCBI-GeneID: 936432
NCBI-ProteinID: NP_391331
Pasteur: BG12425
BSORF: BG12425
UniProt: O06998
Position
complement(3542179..3542691)
Genome map
AA seq 170 aa AA seqDB search
MGILSGNPQDEPMHYGEVFGLWSYVMAGNKMVGNYQMLLNHVGDDDLKKLLRESIEKCQD
EIKQVSTILKENGVALPPASPEPPTADLNDIPPGARFLDPDVAASAAAENAAGLVTCSKM
MGQSIREDIAMMFGQFHMSKAATGAKYLRLLKNKGWLIPPPLHLQKHHEA
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atgggtattttaagcggaaatccgcaggatgaaccgatgcattacggtgaggtattcggc
ttgtggagttatgtgatggcgggcaataaaatggtcggcaattaccaaatgctattgaat
catgtcggtgatgacgacctgaagaagctgcttcgtgagtctattgagaaatgccaagat
gaaatcaaacaggtcagcacgatcctgaaagaaaacggggtggcgctgccgccggcttct
cctgaaccgccgacagcagatcttaacgatattccgcctggtgcacggtttctcgatccg
gatgtggcggcttccgcggcagcagaaaatgctgcaggtcttgtgacatgcagcaaaatg
atggggcaatcgattcgtgaggatattgccatgatgtttgggcaatttcatatgtcgaaa
gcggcaaccggcgcaaaatacttaaggctgctaaaaaacaaaggctggctcatcccgccg
ccgcttcatcttcaaaaacatcacgaagcttaa

DBGET integrated database retrieval system