KEGG   Bacillus subtilis subsp. subtilis 168: BSU34520
Entry
BSU34520          CDS       T00010                                 

Symbol
yvdP
Name
(RefSeq) FAD-linked oxidoreductase YvdP
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: FAD_binding_4 BBE
Other DBs
NCBI-GeneID: 936442
NCBI-ProteinID: NP_391332
Pasteur: BG12424
BSORF: BG12424
UniProt: O06997 A0A6M4JPG6
Position
complement(3542943..3544286)
AA seq 447 aa
MGSTQLTGRVIFKGDPGYTEAIKNWNPYVDVYPLVFVFAQNSYDVSNAIKWARENKVPLR
VRSGRHALDKNLSVVSGGIVIDVSDMNKVFLDEENAIATVQTGIPVGPLVKGLARDGFMA
PFGDSPTVGIGGITMGGGFGVLSRSIGLISDNLLALKTVDAKGRIIHADQSHNEDLLWAS
RGGGGGNFGYNTQYTFKVHRAPKTATVFNIIWPWEQLETVFKAWQKWAPFVDERLGCYLE
IYSKINGLCHAEGIFLGSKTELIRLLKPLLHAGTPTEADIKTLYYPDAIDFLDPDEPIPG
RNDQSVKFSSAWGHDFWSDEPISIMRKFLEDATGTEANFFFINWGGAISRVPKDETAFFW
RHPLFYTEWTASWKNKSQEDSNLASVERVRQLMQPYVAGSYVNVPDQNIENFGKEYYGAN
FARLREIKAKYDPENVFRFPQSIPPSR
NT seq 1344 nt   +upstreamnt  +downstreamnt
atgggatcaacacagttgacagggcgtgtaatcttcaaaggagaccccggctatacagag
gctattaagaattggaacccttatgtggatgtctatcctcttgtctttgtttttgcgcaa
aattcatacgatgtaagtaatgccattaaatgggctcgtgagaataaagtgcccttacgt
gtcagaagcggtcgccatgctttagataagaacctttcagtagtaagtggaggaattgtt
attgatgtgagtgacatgaataaagttttcttagatgaagaaaacgctattgcaaccgtt
caaactggtattcccgttggcccgcttgtaaagggattagctcgagacggttttatggct
ccgtttggagatagcccaacagttggaatcgggggaattacgatgggcggcggatttggt
gtactctcacgatcgattggccttataagtgataaccttctcgcgctgaaaacggtagat
gcaaaaggaaggattattcacgcagatcaatctcacaatgaggatttgctatgggcttct
agaggcggaggaggaggtaactttggatataatacccaatatacattcaaagttcatcgt
gcccctaaaactgcaaccgtcttcaatattatctggccgtgggaacaattagaaacggta
tttaaagcttggcagaaatgggctccgtttgtagatgaacgattaggatgctaccttgaa
atttacagcaaaataaatggtttgtgtcatgcagaaggaattttcctcggttcgaaaact
gaattgattcgattattaaaacctttattacatgcgggaactccaacagaagcagatatc
aaaacattatactatccagatgctatagatttcttagaccctgacgaacccatccctggc
agaaatgatcagagtgttaaattctcctcggcatggggtcatgatttttggtctgacgaa
cccatttcaatcatgagaaaatttttggaagatgctactggaacagaagccaatttcttt
tttatcaattggggtggtgctataagcagagtccctaaagacgaaactgcctttttttgg
cgccatccattattttatacggaatggacggctagttggaaaaataaatcacaagaagat
tcaaatcttgcatcagttgaaagagtgcgtcagctgatgcaaccatatgtagcaggttca
tatgttaatgttccagatcaaaacattgaaaacttcggaaaagaatattatggcgcaaac
tttgcgcggcttcgagaaataaaggcgaaatatgaccccgaaaatgtatttcgttttccg
caaagcatcccgccatctcgttaa

DBGET integrated database retrieval system