KEGG   Bacillus subtilis subsp. subtilis 168: BSU34530Help
Entry
BSU34530          CDS       T00010                                 

Gene name
cotR
Definition
(RefSeq) sporulation hydrolase CotR
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Patatin
Motif
Other DBs
NCBI-GeneID: 936427
NCBI-ProteinID: NP_391333
Pasteur: BG12423
BSORF: BG12423
UniProt: O06996
Position
3544642..3545604
Genome map
AA seq 320 aa AA seqDB search
MAKYRIMTFDGGGTLGALSLQLLNRLARQNPKLISRTHVFSGNSIGSFTALALASGRSPR
ETLQYFEDEILPAFSISRPGGPVFNQQLPYSGFIKAVRNFFPADLQLIDLRKRIVVPSFK
LYSQKLDRWTPVLFHNFPGSPYLNEKVSDVILRSSGAPATQRAYQNYVDGYVVATNPSTA
SIAFAVGKANVPLDQIAVLSIGTGEAPTRLRRDTRGWGMVSADNIRPENLKNLPPNWGVL
LDRSPNEPLLPFLQMIAGGNGYYESMVSANLLGDRFFRLDPRIPNFSKTDPAVVPAVIEI
ANKTNLQPANQFIEKNWGSK
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
ttggcaaaatatcggattatgacctttgacggcggcggtaccttaggtgctttaagttta
caactattaaacagattggctaggcaaaacccgaagttaattagtcgaacccatgtattt
tcgggaaattcaatcggttcatttactgcccttgcattagcaagcggaagatctccgagg
gaaacacttcagtattttgaggatgaaatcctacccgcattcagcatttcccggccaggc
ggacctgttttcaaccaacaattaccctattccggttttattaaagcggtaagaaatttt
ttcccagcagatcttcaacttatagatttaagaaaacgaattgttgtcccatcattcaaa
ttatactctcaaaaactggaccgttggactcctgtcttatttcacaattttcccggctct
ccctatttaaatgaaaaagtgagtgatgtcatactgcggagcagcggtgctcccgcgacg
caacgcgcctatcaaaactatgtggacggatatgtagtagcaacgaatcccagtacagcc
agtatcgcgtttgcagttggtaaagccaacgtgccattggatcaaattgcggtattgtcc
atcggaacaggtgaagccccgactcggttaagaagagatacgaggggatggggaatggta
agtgcagataacatacgtcccgaaaatctgaagaaccttcctccaaattggggagtcctt
ttggacaggtcgcctaatgaacctttactgccatttcttcagatgattgctggcggtaat
gggtactatgaatccatggtcagtgcgaatcttctgggagatcgttttttccggttagat
ccgcggattccgaacttctccaaaacggaccctgccgtcgttcccgctgtcattgaaatt
gcgaacaaaacaaacttacagcctgcgaatcaatttatagagaagaactgggggagcaaa
taa

DBGET integrated database retrieval system