KEGG   Bacillus subtilis subsp. subtilis 168: BSU34530
Entry
BSU34530          CDS       T00010                                 

Symbol
cotR
Name
(RefSeq) sporulation hydrolase CotR
  KO
K25519  putative sporulation hydrolase
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99978 Cell growth
    BSU34530 (cotR)
SSDB
Motif
Pfam: Patatin
Other DBs
NCBI-GeneID: 936427
NCBI-ProteinID: NP_391333
Pasteur: BG12423
BSORF: BG12423
UniProt: O06996 A0A6M4JPF3
Position
3544642..3545604
AA seq 320 aa
MAKYRIMTFDGGGTLGALSLQLLNRLARQNPKLISRTHVFSGNSIGSFTALALASGRSPR
ETLQYFEDEILPAFSISRPGGPVFNQQLPYSGFIKAVRNFFPADLQLIDLRKRIVVPSFK
LYSQKLDRWTPVLFHNFPGSPYLNEKVSDVILRSSGAPATQRAYQNYVDGYVVATNPSTA
SIAFAVGKANVPLDQIAVLSIGTGEAPTRLRRDTRGWGMVSADNIRPENLKNLPPNWGVL
LDRSPNEPLLPFLQMIAGGNGYYESMVSANLLGDRFFRLDPRIPNFSKTDPAVVPAVIEI
ANKTNLQPANQFIEKNWGSK
NT seq 963 nt   +upstreamnt  +downstreamnt
ttggcaaaatatcggattatgacctttgacggcggcggtaccttaggtgctttaagttta
caactattaaacagattggctaggcaaaacccgaagttaattagtcgaacccatgtattt
tcgggaaattcaatcggttcatttactgcccttgcattagcaagcggaagatctccgagg
gaaacacttcagtattttgaggatgaaatcctacccgcattcagcatttcccggccaggc
ggacctgttttcaaccaacaattaccctattccggttttattaaagcggtaagaaatttt
ttcccagcagatcttcaacttatagatttaagaaaacgaattgttgtcccatcattcaaa
ttatactctcaaaaactggaccgttggactcctgtcttatttcacaattttcccggctct
ccctatttaaatgaaaaagtgagtgatgtcatactgcggagcagcggtgctcccgcgacg
caacgcgcctatcaaaactatgtggacggatatgtagtagcaacgaatcccagtacagcc
agtatcgcgtttgcagttggtaaagccaacgtgccattggatcaaattgcggtattgtcc
atcggaacaggtgaagccccgactcggttaagaagagatacgaggggatggggaatggta
agtgcagataacatacgtcccgaaaatctgaagaaccttcctccaaattggggagtcctt
ttggacaggtcgcctaatgaacctttactgccatttcttcagatgattgctggcggtaat
gggtactatgaatccatggtcagtgcgaatcttctgggagatcgttttttccggttagat
ccgcggattccgaacttctccaaaacggaccctgccgtcgttcccgctgtcattgaaatt
gcgaacaaaacaaacttacagcctgcgaatcaatttatagagaagaactgggggagcaaa
taa

DBGET integrated database retrieval system