KEGG   Bacillus subtilis subsp. subtilis 168: BSU34540Help
Entry
BSU34540          CDS       T00010                                 

Gene name
clpP
Definition
(RefSeq) ATP-dependent Clp protease proteolytic subunit
  KO
K01358  ATP-dependent Clp protease, protease subunit [EC:3.4.21.92]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:bsu01002]
    BSU34540 (clpP)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.92  endopeptidase Clp
     BSU34540 (clpP)
Peptidases [BR:bsu01002]
 Serine Peptidases
  Family S14: ClpP endopeptidase family
   BSU34540 (clpP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CLP_protease
Motif
Other DBs
NCBI-GeneID: 938625
NCBI-ProteinID: NP_391334
Pasteur: BG19016
BSORF: BG19016
UniProt: P80244
Structure
PDB: 

Position
3546234..3546827
Genome map
AA seq 197 aa AA seqDB search
MNLIPTVIEQTNRGERAYDIYSRLLKDRIIMLGSAIDDNVANSIVSQLLFLAAEDPEKEI
SLYINSPGGSITAGMAIYDTMQFIKPKVSTICIGMAASMGAFLLAAGEKGKRYALPNSEV
MIHQPLGGAQGQATEIEIAAKRILLLRDKLNKVLAERTGQPLEVIERDTDRDNFKSAEEA
LEYGLIDKILTHTEDKK
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgaatttaatacctacagtcattgaacaaacgaaccgcggggaaagagcgtatgacatt
tattctcgtctattaaaggatcgtatcatcatgcttggatctgcgattgatgacaacgtt
gcgaactccatcgtgtcacagcttttattcttagcagcagaagaccctgaaaaagaaatt
tctctttacatcaacagcccgggcggctctattacagccggtatggcgatctatgatacc
atgcagtttattaagccgaaggtatctacaatttgtatcggtatggctgcgtcaatgggc
gcgttcctgcttgcagccggcgaaaaaggcaaacgctatgcgcttccaaacagtgaagtc
atgattcaccagcctcttggcggtgcgcaaggtcaagcgacagaaattgaaattgctgcg
aaacgcattctcttgcttcgcgacaaattaaacaaagtcctagctgaacgtactggccag
ccgcttgaagtgatcgaacgcgacacagaccgtgataacttcaagtctgctgaagaagcg
cttgaatacggcctgattgacaaaattttgactcacacagaagacaaaaagtaa

DBGET integrated database retrieval system