KEGG   Bacillus subtilis subsp. subtilis 168: BSU34540
Entry
BSU34540          CDS       T00010                                 

Symbol
clpP
Name
(RefSeq) ATP-dependent Clp protease proteolytic subunit
  KO
K01358  ATP-dependent Clp protease, protease subunit [EC:3.4.21.92]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:bsu01002]
    BSU34540 (clpP)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.92  endopeptidase Clp
     BSU34540 (clpP)
Peptidases and inhibitors [BR:bsu01002]
 Serine peptidases
  Family S14: ClpP endopeptidase family
   BSU34540 (clpP)
SSDB
Motif
Pfam: CLP_protease
Other DBs
NCBI-GeneID: 938625
NCBI-ProteinID: NP_391334
Pasteur: BG19016
BSORF: BG19016
UniProt: P80244 A0A6M3ZGI2
Structure
Position
3546234..3546827
AA seq 197 aa
MNLIPTVIEQTNRGERAYDIYSRLLKDRIIMLGSAIDDNVANSIVSQLLFLAAEDPEKEI
SLYINSPGGSITAGMAIYDTMQFIKPKVSTICIGMAASMGAFLLAAGEKGKRYALPNSEV
MIHQPLGGAQGQATEIEIAAKRILLLRDKLNKVLAERTGQPLEVIERDTDRDNFKSAEEA
LEYGLIDKILTHTEDKK
NT seq 594 nt   +upstreamnt  +downstreamnt
atgaatttaatacctacagtcattgaacaaacgaaccgcggggaaagagcgtatgacatt
tattctcgtctattaaaggatcgtatcatcatgcttggatctgcgattgatgacaacgtt
gcgaactccatcgtgtcacagcttttattcttagcagcagaagaccctgaaaaagaaatt
tctctttacatcaacagcccgggcggctctattacagccggtatggcgatctatgatacc
atgcagtttattaagccgaaggtatctacaatttgtatcggtatggctgcgtcaatgggc
gcgttcctgcttgcagccggcgaaaaaggcaaacgctatgcgcttccaaacagtgaagtc
atgattcaccagcctcttggcggtgcgcaaggtcaagcgacagaaattgaaattgctgcg
aaacgcattctcttgcttcgcgacaaattaaacaaagtcctagctgaacgtactggccag
ccgcttgaagtgatcgaacgcgacacagaccgtgataacttcaagtctgctgaagaagcg
cttgaatacggcctgattgacaaaattttgactcacacagaagacaaaaagtaa

DBGET integrated database retrieval system