KEGG   Bacillus subtilis subsp. subtilis 168: BSU34550Help
Entry
BSU34550          CDS       T00010                                 

Gene name
pgcM
Definition
(RefSeq) beta-phosphoglucomutase
  KO
K01838  beta-phosphoglucomutase [EC:5.4.2.6]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00500  Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BSU34550 (pgcM)
Enzymes [BR:bsu01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.6  beta-phosphoglucomutase
     BSU34550 (pgcM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase Hydrolase_like MinC_N BING4CT HAD
Motif
Other DBs
NCBI-GeneID: 938624
NCBI-ProteinID: NP_391335
Pasteur: BG12422
BSORF: BG12422
UniProt: O06995
Structure
PDB: 

Position
complement(3546873..3547553)
Genome map
AA seq 226 aa AA seqDB search
MKAVIFDLDGVITDTAEYHFLAWKHIAEQIDIPFDRDMNERLKGISREESLESILIFGGA
ETKYTNAEKQELMHRKNRDYQMLISKLTPEDLLPGIGRLLCQLKNENIKIGLASSSRNAP
KILRRLAIIDDFHAIVDPTTLAKGKPDPDIFLTAAAMLDVSPADCAAIEDAEAGISAIKS
AGMFAVGVGQGQPMLGADLVVRQTSDLTLELLHEEWEQYRIRESIP
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcggtcatttttgatttagacggagtgataacagatactgctgaatatcatttt
ctcgcttggaagcacatcgcagaacaaatcgatatcccttttgacagagacatgaatgaa
aggctaaaaggaatcagcagagaagagtcacttgaaagcatattgatctttggcggggcg
gaaacaaagtatacaaatgcggagaaacaagagcttatgcatcggaaaaatcgcgattat
caaatgctgatcagcaaattgacgccggaagatcttttaccggggattggcaggcttcta
tgtcaattgaaaaacgaaaatataaaaatcgggttagcatcttcaagtcgcaatgctcct
aagattttaagacgcttggcaattatcgatgattttcatgccattgttgatccgacgact
cttgcgaaggggaagcctgatcctgacatctttttaacagctgcagcgatgctcgatgtt
tcccctgctgattgcgcggcaatagaagacgcagaagcaggcatttctgcaatcaaatct
gcggggatgtttgcggttggtgtcggtcaaggacagccgatgcttggtgctgatctggtt
gtgaggcagacgagtgatttgacgcttgagctgttacatgaggaatgggagcagtataga
ataagggagtcaattccttga

DBGET integrated database retrieval system