KEGG   Bacillus subtilis subsp. subtilis 168: BSU34560Help
Entry
BSU34560          CDS       T00010                                 

Gene name
malL
Definition
(RefSeq) oligo-1,6-glucosidase 1
  KO
K01182  oligo-1,6-glucosidase [EC:3.2.1.10]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00052  Galactose metabolism
bsu00500  Starch and sucrose metabolism
bsu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    BSU34560 (malL)
   00500 Starch and sucrose metabolism
    BSU34560 (malL)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.10  oligo-1,6-glucosidase
     BSU34560 (malL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C hDGE_amylase DUF3459
Motif
Other DBs
NCBI-GeneID: 938623
NCBI-ProteinID: NP_391336
Pasteur: BG12421
BSORF: BG12421
UniProt: O06994
Structure
PDB: 

Position
complement(3547550..3549235)
Genome map
AA seq 561 aa AA seqDB search
MSEWWKEAVVYQIYPRSFYDANGDGFGDLQGVIQKLDYIKNLGADVIWLSPVFDSPQDDN
GYDISDYKNMYEKFGTNEDMFQLIDEVHKRGMKIVMDLVVNHTSDEHAWFAESRKSKDNP
YRDYYLWKDPKPDGSEPNNWGSIFSGSAWTYDEGTGQYYLHYFSKKQPDLNWENEAVRRE
VYDVMRFWMDRGVDGWRMDVIGSISKYTDFPDYETDHSRSYIVGRYHSNGPRLHEFIQEM
NREVLSHYDCMTVGEANGSDIEEAKKYTDASRQELNMIFTFEHMDIDKEQNSPNGKWQIK
PFDLIALKKTMTRWQTGLMNVGWNTLYFENHDQPRVISRWGNDRKLRKECAKAFATVLHG
MKGTPFIYQGEEIGMVNSDMPLEMYDDLEIKNAYRELVVENKTMSEKEFVKAVMIKGRDH
ARTPMQWDAGKHAGFTAGDPWIPVNSRYQDINVKESLEDQDSIFFYYQKLIQLRKQYKIM
IYGDYQLLQENDPQVFSYLREYRGEKLLVVVNLSEEKALFEAPPELIHERWKVLISNYPQ
ERADLKSISLKPYEAVMGISI
NT seq 1686 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaatggtggaaagaagctgtcgtttatcaaatttacccgcgcagtttttatgat
gccaatggagatggattcggagatttgcaaggtgtgattcaaaagctggattacatcaaa
aacctcggggcggatgtcatctggctctccccggtatttgattccccgcaggatgacaac
ggatatgatatcagcgattacaaaaacatgtacgaaaagtttgggacaaatgaagatatg
tttcagctgattgatgaagtccataaacgcggaatgaaaatcgtcatggatttggtcgtg
aaccacacatcagatgagcatgcttggtttgctgaaagccgcaagtcgaaggacaatcct
taccgggattattatctttggaaagatcctaaaccggacggctcagagccgaataattgg
ggatcgatcttttcaggctcagcgtggacatacgatgaaggaacagggcagtattatttg
cactacttttcgaaaaaacagcctgatttaaattgggaaaacgaagccgttcgccgggaa
gtttatgatgtaatgagattctggatggatagaggcgttgacggctggcggatggatgtg
attggctctatttctaaatacaccgattttccggactacgaaacggatcacagccgcagc
tatattgtcggccgttatcactctaacggcccacgtcttcatgagtttattcaagagatg
aacagggaagtgctttctcattacgactgcatgacagtcggagaggcaaacggctctgat
attgaagaggcgaaaaagtacacagatgcaagcaggcaagagctgaatatgatctttaca
tttgaacatatggatattgataaagaacaaaactcgccaaatgggaaatggcagatcaag
ccgtttgatttgattgctttaaaaaagacgatgacaaggtggcagaccgggttaatgaat
gtcggctggaataccctttattttgagaaccatgaccagccgagggttatttcccgctgg
ggcaatgacaggaaactgcgtaaggaatgtgcgaaggcatttgcaacggttctgcacggc
atgaaaggaacgccgtttatttaccagggagaagaaatcggcatggtcaacagcgatatg
ccgctggagatgtatgatgatcttgaaataaagaatgcatatcgtgaactagtcgtcgaa
aacaaaacgatgtcagaaaaagagtttgtcaaagccgtgatgataaaaggaagggatcat
gcgagaacaccgatgcagtgggatgccggaaaacatgcgggattcacagccggagacccg
tggataccggtaaattcccgctatcaagatatcaatgtgaaagagtctttggaagatcaa
gattcgattttcttttactatcagaagctcattcaattacgaaagcaatataagattatg
atatatggcgattatcagctgttgcaggagaatgatccgcaggtcttttcttaccttcga
gaatatcgaggggaaaagcttcttgtcgttgtgaatttatcggaagaaaaggctctgttc
gaagcgcctccagaactgattcatgagcgttggaaagtgctaatttcaaactatccgcag
gagcgggctgacttaaagagtattagcctcaaaccttatgaagctgtgatgggcattagt
atatga

DBGET integrated database retrieval system