KEGG   Bacillus subtilis subsp. subtilis 168: BSU34570Help
Entry
BSU34570          CDS       T00010                                 

Gene name
yvdK
Definition
(RefSeq) maltose phosphorylase
  KO
K00691  maltose phosphorylase [EC:2.4.1.8]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00500  Starch and sucrose metabolism
bsu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BSU34570 (yvdK)
Enzymes [BR:bsu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.8  maltose phosphorylase
     BSU34570 (yvdK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_65m Glyco_hydro_65N Glyco_hydro_65C
Motif
Other DBs
NCBI-GeneID: 938621
NCBI-ProteinID: NP_391337
Pasteur: BG12420
BSORF: BG12420
UniProt: O06993
Position
complement(3549228..3551501)
Genome map
AA seq 757 aa AA seqDB search
MINQRLFEIDEWKIKTNTFNKEHTRLLESLTSLANGYMGVRGNFEEGYSGDSHQGTYIAG
VWFPDKTRVGWWKNGYPEYFGKVINAMNFMGIGLYVDGEKIDLHQNPIELFEVELNMKEG
ILRRSAVVRIQDKTVRIRSERFLSLAVKELCAIHYEAECLTGDAVITLVPYLDGNVANED
SNYQEQFWQEEAKGADSHSGHLAAKTIENPFGTPRFTVLAAMANETEGFVHESFKTTEMY
VENRYSYQTKASLKKFVIVTTSRDFREEELLSKAKELLADVVENGYEDAKRRHTDRWKER
WAKADIEIKGDEELQQGIRYNIFQLFSTYYGGDARLNIGPKGFTGEKYGGAAYWDTEAYA
VPMYLATAEPEVTKNLLLYRYHQLEAAKRNAAKLGMKGALYPMVTFTGDECHNEWEITFE
EIHRNGAICYAIYNYINYTGDRNYMEEYGIDVLVAVSRFWADRVHFSKRKNKYMIHGVTG
PNEYENNVNNNWYTNVIAAWTLEYTLQSLESISAEKRRHLDVQEVELEVWREIIQHMYYP
FSEELQIFVQHDTFLDKDLQTVDELDPAERPLYQNWSWDKILRSNFIKQADVLQGIYLFN
DRFTMEEKRRNFEFYEPMTVHESSLSPSVHAILAAELKLEKKALELYKRTARLDLDNYNH
DTEEGLHITSMTGSWLAIVHGFAGMRTANETLSFAPFLPKEWDEYSFNINYRNRLINVTV
DEKRVIFELVKGEPLHMNVYEEPVVLQGRCERRTPNE
NT seq 2274 nt NT seq  +upstreamnt  +downstreamnt
atgataaatcagcggttatttgagattgatgaatggaaaatcaaaacaaatacatttaat
aaggagcatacacggctgctggaaagcctgacgtctcttgccaatggctatatgggggtc
agagggaattttgaagaaggctattcaggcgacagtcaccaaggcacatatattgcaggc
gtgtggttccccgacaaaacgcgagtaggctggtggaaaaacgggtatccagaatatttc
ggaaaagtgatcaatgcgatgaactttatgggcataggcctatatgttgacggtgaaaaa
atcgatctccatcaaaacccaatcgaattatttgaggtagaactcaatatgaaagagggg
attctgcggcgaagcgctgttgtccgcattcaagataaaaccgtcagaatcaggtcagag
cggtttcttagccttgctgtaaaagaactctgtgcgattcattatgaagcggagtgcttg
acgggagatgctgtcattacgcttgttccttacctggatggaaatgtggcaaatgaagat
tctaactaccaagaacagttttggcaggaggaagcgaaaggtgctgattctcacagcggc
catttagcggcaaaaacgatcgaaaatccatttggaacaccgcgcttcacggtattagcc
gcaatggcaaacgagacggagggttttgtccatgaaagctttaaaacgactgaaatgtat
gtcgagaatcgctacagttatcaaacgaaggcatcattgaaaaagtttgtgattgtcacg
acttcccgtgattttcgggaggaagagcttttatcgaaagccaaggagcttttggcggat
gtggtagagaacggctatgaagatgcaaaacggaggcacactgatcgatggaaggaaaga
tgggcaaaagcggacattgagattaaaggagatgaggagcttcaacaaggaatccgctac
aatatctttcagttattctcgacatattacgggggcgatgcccgtttgaatatcgggccg
aaaggatttactggcgagaaatatggaggtgccgcatattgggatactgaggcgtacgcc
gttccgatgtatttggcgacagccgagccggaggtgacgaaaaacctgcttttgtatcgc
tatcatcagttggaggctgccaaacgaaacgctgcaaaattggggatgaagggggcactt
tatccgatggtgacgttcacaggtgatgaatgccacaacgaatgggaaatcacctttgaa
gaaattcaccgcaatggcgcgatctgttatgcgatctacaattatatcaattatacaggc
gaccgtaactatatggaagaatacgggatagacgtacttgtggcagtcagcagattttgg
gccgaccgtgttcacttctcgaaacgaaaaaataagtatatgatccatggcgtcacaggg
ccgaatgaatacgaaaacaacgttaacaacaattggtatacgaatgtcattgcggcttgg
acgttggagtatactctacaaagtctcgaaagtatctcagcggagaaacgccgccatctg
gatgtgcaggaagtagaattggaagtctggagagaaatcatccagcacatgtactatcca
tttagtgaagaactgcaaattttcgttcagcatgacacgttcttggacaaagacctgcaa
acagttgacgaattagatccagcggaacggcctctttaccagaattggtcatgggacaag
attctccgctccaattttattaagcaggcagatgttctccaaggcatttatctttttaat
gaccgttttacaatggaagaaaaacggcgaaattttgaattttatgagccgatgactgtt
catgaatcaagcctatcgccctctgtccatgcgattctcgcagccgaactcaagctggaa
aagaaagcgctcgaattatataagcgcacagcaaggcttgatcttgataattacaatcat
gatacggaagaaggcttgcatattacttcaatgacgggtagctggctggcaatcgttcat
ggctttgcaggcatgcgcaccgcgaatgagacgctgtcatttgctccgtttttgccgaaa
gaatgggacgaatattcattcaacatcaattatcgaaatcgattaatcaatgtgacggtt
gacgaaaagcgcgttatttttgagcttgtaaaaggcgagccgctgcacatgaacgtttat
gaggaaccggttgtcctacagggacgatgtgaaaggagaacgcctaatgagtga

DBGET integrated database retrieval system