KEGG   Bacillus subtilis subsp. subtilis 168: BSU34580Help
Entry
BSU34580          CDS       T00010                                 

Gene name
yvdJ
Definition
(RefSeq) maltodextrin utilization protein YvdJ
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF1189
Motif
Other DBs
NCBI-GeneID: 936479
NCBI-ProteinID: NP_391338
Pasteur: BG12419
BSORF: BG12419
UniProt: O06992
Position
complement(3551479..3552363)
Genome map
AA seq 294 aa AA seqDB search
MKNLENKSFIIRCLKAAASPSGVCRYGNTFSWLQLSFLFLFLTACLMAPLAVSFVKMDRF
SVSSFMPSAIQGVNDQFADQLQGFQIRNGKLTGGKSSERIEDGQNVMAVDMKHEYETSGE
NGRLKVTGFENAIIFQPDQLVITDQNETGFSVGYAKMDVKLEKPNVHDVEVLIDTLWLAQ
YKPMIMMLAYTVVSMIQLLLTFVLAGGLWITKISNMVSIASFKEAASIAICASALPAFAA
AAIGMVHFDLITVLMIHSCGVTLMISFAFRYLTKTRRDNGNLHSGGNDDKSAVI
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgaagaatctggagaataaaagctttatcatccgctgcctgaaggcggctgcatcccca
tcaggtgtttgccgctatgggaataccttcagctggctgcagctctcttttctctttctg
tttttaacggcctgcttaatggcgccgttagcggtttcgtttgtgaaaatggatcgcttc
agcgtttcatctttcatgccgtcagcgattcaaggagttaatgatcaatttgctgatcaa
ttgcagggttttcaaatcaggaacggaaaactaacaggcgggaagagctctgagaggatt
gaagatgggcagaatgtgatggcagtcgatatgaagcatgaatatgagacaagcggtgaa
aatgggcgattgaaagtaactggatttgaaaacgccatcatatttcaacctgatcaactg
gtgatcaccgatcaaaacgaaacggggttttctgttggctatgcgaaaatggacgttaag
ctcgagaaaccaaacgtccatgatgtagaggtcttgatcgatacattgtggttggcacag
tataagccgatgatcatgatgctggcatatacggtggtttctatgatccagcttttgtta
acgtttgttcttgcaggtggcctctggatcacaaaaatatcaaacatggtctctattgca
tcattcaaggaagcggcctctatagcgatttgcgcatcagcactgccggcatttgcggca
gctgctatcggcatggttcattttgatttgattactgtattgatgatccattcgtgtggc
gttactttgatgatctcttttgcatttagatatttgaccaaaacccgccgtgataatgga
aacttacattcgggaggaaatgatgataaatcagcggttatttga

DBGET integrated database retrieval system