KEGG   Bacillus subtilis subsp. subtilis 168: BSU34590Help
Entry
BSU34590          CDS       T00010                                 

Gene name
mdxG
Definition
(RefSeq) maltodextrin transport system permease protein MdxG
  KO
K15772  arabinogalactan oligomer / maltooligosaccharide transport system permease protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02010  ABC transporters
Module
bsu_M00491  arabinogalactan oligomer/maltooligosaccharide transport system
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BSU34590 (mdxG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU34590 (mdxG)
Transporters [BR:bsu02000]
 ABC Transporters, Prokaryotic Type
  Saccharide, polyol, and lipid transporters
   Arabinogalactan oligomer/maltooligosaccharide transport system [MD:M00491]
    BSU34590 (mdxG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1 ODV-E18
Motif
Other DBs
NCBI-GeneID: 936499
NCBI-ProteinID: NP_391339
Pasteur: BG12418
BSORF: BG12418
UniProt: O06991
Position
complement(3552369..3553205)
Genome map
AA seq 278 aa AA seqDB search
MNASTARMLNKICTYLFLTLLSIVIIYPLLITASSAFRVGNSAAFQLDFSGSWTLDHFKR
LFDETLYLNWYSNTLVIALSVMVLQVTIVTLAGYSYSRYRFAGRKKSLIFFLIIQMVPTM
AALTAFYVLAMLIGALDQYWFLTAIYIGGGIPMNTWLMKGYFDTVPREIDEAARIDGAGH
LRIFASIVLPLVKPMLAVQALWAFMAPFGDYLLTKFLLRSPERLTIAVGLQSFISNPQQQ
KVALFAAGAILAALPICVLFFFLQKNFVSGLTAGGTKG
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
gtgaacgcgagcactgccagaatgcttaataaaatctgtacgtatttatttttgacgctt
ttaagtattgtcattatatatccgttgctgattacggcatcatcagccttccgtgtgggg
aattcggcggcttttcagctcgatttttcgggttcttggacattggatcattttaagcgg
ctatttgacgaaacgctttatctcaattggtacagcaatacacttgtcatcgcgctatcg
gtcatggttttgcaggttacgattgtgacacttgccgggtactcgtacagccgctatcgg
tttgcaggcagaaaaaagagcctgatattctttttaatcattcaaatggtgccgacaatg
gcggcgctgactgctttttatgtcttggcgatgctaataggcgcactcgatcaatactgg
tttttaacagcgatctatatcggcggcggaattccgatgaacacgtggctgatgaaaggt
tattttgatactgtgccgagagaaattgatgaagccgcgcgaattgacggagcgggacat
ctgaggattttcgcttcaattgttctaccgcttgttaagccaatgctcgcggtacaagcg
ctttgggcgtttatggcaccgtttggcgactatttgctgacgaaatttctgcttcgctca
ccggaaaggctgaccatcgctgtaggattacaatcctttatttctaatccgcagcagcaa
aaagtagctctatttgcagccggtgccatactagccgcactgccgatatgcgttctattc
ttttttctccaaaagaactttgtgtccggtttgacagccggcggaacaaaggggtaa

DBGET integrated database retrieval system