KEGG   Bacillus subtilis subsp. subtilis 168: BSU34610Help
Entry
BSU34610          CDS       T00010                                 

Gene name
mdxE
Definition
(RefSeq) maltodextrin-binding protein MdxE
  KO
K15770  arabinogalactan oligomer / maltooligosaccharide transport system substrate-binding protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02010  ABC transporters
Module
bsu_M00491  arabinogalactan oligomer/maltooligosaccharide transport system
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BSU34610 (mdxE)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU34610 (mdxE)
Transporters [BR:bsu02000]
 ABC Transporters, Prokaryotic Type
  Saccharide, polyol, and lipid transporters
   Arabinogalactan oligomer/maltooligosaccharide transport system [MD:M00491]
    BSU34610 (mdxE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_8 SBP_bac_1 SBP_bac_6 SBP_bac_11 FTCD_C
Motif
Other DBs
NCBI-GeneID: 936522
NCBI-ProteinID: NP_391341
Pasteur: BG12416
BSORF: BG12416
UniProt: O06989
Position
complement(3554553..3555806)
Genome map
AA seq 417 aa AA seqDB search
MVLLKKGFAILAASFLAIGLAACSSSKNPASSDGKKVLTVSVEETYKEYIESIKTKFEKE
NDVTVKIVEKQMFEQLEALPLDGPAGNAPDVMLAAYDRIGGLGQQGHLLDIKPSNTKSFG
DKEMQQVTVDGKVYGMPLVIETLILYYNKDLLKTAPKTFKDLEKLTEDPRFAFASEKGKS
TGFLAKWTDFYMSYGLLAGYGGYVFGKNGTDSGDIGLNNKGAVEAVKYAEKWFETYWPKG
MQDNSSADDFIQQMFLEGKAAAIIGGPWSAANYKEAKLNYGAAPIPTLPNGEEYAPFAGG
KGWVASKYTKEPELAEKWLEYAANDANAYAFYEDTNEVPANTAARKKADEQKNELTSAVI
KQYETATPTPNIPEMAEVWTGAESLIFDAASGKKSTQTSANDAVNVIKENIKEKYVK
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atggttcttttaaaaaaggggttcgccatattggcggcatcattcctggcaatcggcctt
gccgcctgctcaagttcaaaaaatccagcaagctctgatggcaaaaaggtgctgactgtg
tctgtcgaagaaacgtataaagaatacattgaaagcataaaaacaaagttcgaaaaagaa
aatgatgtcacagtaaaaattgttgaaaagcaaatgttcgaacagttagaagcgcttcct
cttgatggcccggcgggtaatgcgcctgatgttatgcttgctgcatatgaccggatcggc
ggtttgggacaacaaggacatttacttgatattaagccatctaacacaaaaagctttggt
gataaagaaatgcagcaggtgacagttgacggcaaagtgtacggaatgccgctagtcatt
gagacacttattttgtattacaacaaagatcttttaaaaacagcgccaaaaacatttaaa
gaccttgaaaagttaacggaagatcctcgattcgcgtttgcttcggaaaaaggaaaatca
accggatttttagcaaaatggactgacttttatatgtcgtacggcttattggctggatac
ggcggatatgtgtttggaaaaaacggcacagattccggggacatcggcctgaacaataaa
ggggctgtagaagcggtgaaatatgcggagaaatggtttgagacatattggccgaaagga
atgcaagacaattcaagcgcagacgactttattcagcagatgtttttagaaggcaaagcg
gctgcgatcattggcggtccttggtcagctgccaactataaagaggctaaattgaactac
ggagcggctcccattccgacattgccaaatggagaagaatacgccccttttgctggcggg
aagggctgggttgcctcgaaatatacaaaagagcccgagctggctgaaaaatggcttgag
tatgctgcaaatgatgccaatgcttacgctttttatgaggatacaaacgaagttccggcc
aacacggctgcaaggaagaaagccgatgagcaaaagaatgaactgacgtcagctgtgatt
aaacaatatgaaacagcaacgccgactccaaatattccggaaatggctgaagtatggaca
ggagcggaaagtttaatttttgatgcagcttcaggaaaaaaatcgacacaaacatcagcg
aatgatgctgtaaacgtcataaaggaaaatattaaagaaaagtatgtgaaataa

DBGET integrated database retrieval system