KEGG   Bacillus subtilis subsp. subtilis 168: BSU34620Help
Entry
BSU34620          CDS       T00010                                 

Gene name
mdxD
Definition
(RefSeq) glucan 1,4-alpha-maltohexaosidase
  KO
K01208  cyclomaltodextrinase / maltogenic alpha-amylase / neopullulanase [EC:3.2.1.54 3.2.1.133 3.2.1.135]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00500  Starch and sucrose metabolism
bsu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BSU34620 (mdxD)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.54  cyclomaltodextrinase
     BSU34620 (mdxD)
    3.2.1.133  glucan 1,4-alpha-maltohydrolase
     BSU34620 (mdxD)
    3.2.1.135  neopullulanase
     BSU34620 (mdxD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Alpha-amylase_N Glyco_hydro_66
Motif
Other DBs
NCBI-GeneID: 936514
NCBI-ProteinID: NP_391342
Pasteur: BG12415
BSORF: BG12415
UniProt: O06988
Position
complement(3555902..3557671)
Genome map
AA seq 589 aa AA seqDB search
MMEYAAIHHQPFSTDAYSYDGRTVHIKIRTKKGDADHIRFIWGDPYEYNDGKWSANEQPM
RKIAATEMHDYWFAEVVPPFRRLQYAFVVTDDHEDIFFGSSGVCPYNEKTLETIHYYFKF
PFVHEADTFQAPEWVKSTVWYQIFPERFANGREDLSPKNALPWGSKDPDVNDFFGGDLQG
IVDKLDYLEDLGVNGIYLTPIFSAPSNHKYDTLDYFSIDPHFGDPELFRTLVSQLHQRGM
RIMLDAVFNHIGSASPQWQDVVKNGDQSRYKDWFHIHSFPVTDDNYDRFAFTADMPKLNT
ANPEVQKYLLDIALYWIREFDIDGWRLDVANEVDHVFWKTFRQAVSTEKPDVYILGEIWH
SAEPWLRGDEFHAAMNYPFTEPMIEYFADQTISASRMAHRVNAHLMNGMKQANEVMFNLL
DSHDTKRLLTRCRNDEKKARALLAFMFAQTGSPCIYYGTEIGLNGENDPLCRKCMVWEKE
KQNQDMLQFMKRLIALRKQENTLLTEGHLEWNLLDDKNDFISFSRTLDEKILIYFFNQGN
VVQHVSLRELNIDRNKKICDAWTEQPLQHHDVIAVQPGEFLILSAAAPV
NT seq 1770 nt NT seq  +upstreamnt  +downstreamnt
atgatggaatatgcagcgattcatcaccagccattcagcacagatgcttattcttatgat
gggcggactgtgcatatcaagattcggacgaaaaaaggtgatgcagatcacattcgattc
atttggggtgatccctatgagtacaacgacggcaaatggtcggcaaacgagcagccgatg
aggaaaattgctgctacagaaatgcatgactattggtttgctgaagtggtgccgccattt
aggcgtttacaatatgcgtttgttgtaacagacgatcatgaagacatctttttcggaagt
tcgggtgtatgcccttataacgaaaaaacactggaaacgattcattattactttaaattt
ccgtttgttcacgaggctgatacatttcaagcgcctgaatgggtcaagtcaacggtttgg
tatcaaatttttccggagcgttttgcaaatggaagagaagacttgtcaccgaagaatgca
ttgccgtgggggagcaaggacccggacgtcaatgatttttttggaggggatttacaagga
attgttgacaagcttgattatttagaggatttaggggtgaacggcatttatctgacaccg
atcttttccgcgccttctaatcataaatacgacacgctggattacttttctattgatccg
catttcggggatcctgagctttttcgtacattggtcagccagctgcatcagcgggggatg
agaattatgcttgatgcggtttttaaccatataggaagcgcgtctccgcaatggcaggat
gtcgtcaaaaacggagatcaatcccgctataaggactggttccatattcactcttttccc
gtcacagacgacaattatgacagatttgcttttacagctgatatgccgaagctaaacacg
gctaatcccgaggtgcagaaatatttgcttgatattgctttgtactggattcgcgaattt
gacattgacggctggcgtttggatgtcgcaaatgaagtggatcacgttttttggaagaca
tttaggcaggctgtatctactgaaaagcctgatgtttatattttaggtgagatctggcat
tctgccgaaccctggcttagaggggatgaatttcatgcggcgatgaattacccttttaca
gagcctatgattgaatactttgctgaccagacgatctcagcttcacgtatggctcaccgt
gtcaatgcacatttgatgaatggaatgaagcaggccaatgaggtgatgtttaatttactg
gatagccatgatacaaagcgccttttgaccagatgccgcaatgatgagaagaaagcacgc
gcgttgctggcctttatgtttgcccagacaggctcaccatgcatttattacggaacggaa
atcgggctgaacggcgaaaatgatccattatgccggaaatgtatggtttgggaaaaagag
aagcaaaaccaagacatgctgcaatttatgaaacggttaattgctttacgcaagcaggaa
aacactttattgactgaaggacatcttgagtggaatctgctggacgacaaaaatgatttc
attagcttttcgcggactcttgatgaaaaaatactgatttatttctttaatcaagggaat
gtggttcaacacgtcagtttacgagagttgaatattgataggaataagaaaatctgtgat
gcatggacagagcagccgctacagcatcacgatgtcattgccgttcagccgggagaattt
ttgattttgagtgctgccgcccctgtataa

DBGET integrated database retrieval system