KEGG   Bacillus subtilis subsp. subtilis 168: BSU34630Help
Entry
BSU34630          CDS       T00010                                 

Gene name
mdxR
Definition
(RefSeq) HTH-type transcriptional regulator YvdE
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peripla_BP_3 LacI Peripla_BP_1 Peripla_BP_4 Malic_M HTH_Tnp_ISL3 HTH_23 MarR
Motif
Other DBs
NCBI-GeneID: 936460
NCBI-ProteinID: NP_391343
Pasteur: BG12414
BSORF: BG12414
UniProt: O06987
Position
complement(3557784..3558734)
Genome map
AA seq 316 aa AA seqDB search
MATLSDVAKKANVSKMTVSRVINHPETVTDELKKLVHSAMKELNYIPNYAARALVQNRTQ
VVKLLILEEMDTTEPYYMNLLTGISRELDRNHYALQLVTRNSLNIGQCDGIIATGLRKND
FEGVIKAFEKPLVVFGQNEMGYDFIDVNNEKGTFMATRHVMGLGEREVVFFGIDLDEPFE
RAREQGYIRAMNKSFKKSNMFRIDNSSKKSECLARELLKSMDNQAAFVCASDRIALGVIR
AAQSLGKRIPEDVAVTGNDGVFLDRISSPRLTTVRQPVVEMGEACAKMLLKKMNEDGAAQ
GSLFFEPELIVRESTL
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atggcaacattgtcagatgtggcgaaaaaagcaaatgtttcgaaaatgacggtatcacga
gtgatcaatcaccctgagacggtgacggatgaattgaaaaagcttgttcattctgcgatg
aaagagctgaattacatccctaattatgcggcgagagcgctcgtgcaaaacagaacacag
gttgtgaaactattgatacttgaggaaatggatacgacagaaccatattacatgaacctg
ctgacaggaatcagcagggagctggatcgcaatcactatgctctccagcttgtgacaaga
aattctcttaatattggccaatgtgacggcattattgccaccggcttgagaaagaacgat
tttgaaggtgtaataaaagcttttgagaagccgctcgtcgtatttggacaaaatgaaatg
ggctatgactttatcgatgtgaataacgagaaaggcacttttatggcaacccgccatgtt
atggggctgggggagcgggaagttgtcttttttggcattgatttagatgagcctttcgaa
cgtgcaagagaacaggggtatatacgggcgatgaataaaagctttaaaaaatcgaatatg
tttcggatcgacaacagttctaagaaaagtgaatgccttgcaagagaactgctgaaatcc
atggacaatcaggccgcatttgtctgcgcatctgatcgaatcgcgctcggcgtcattcgt
gcggcgcaatcccttggaaagcgaattccagaagacgttgcggttaccgggaatgacggt
gtgtttcttgatcgcatctcctcgccgcgcttgactacggtcagacagcctgttgttgaa
atgggggaagcctgtgcgaaaatgttgctgaaaaaaatgaatgaagacggcgctgcacaa
ggaagtctattttttgaaccagagttaattgtacgagaatcaacgctgtaa

DBGET integrated database retrieval system