KEGG   Bacillus subtilis subsp. subtilis 168: BSU34650
Entry
BSU34650          CDS       T00010                                 

Symbol
yvdC
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: MazG PRA-PH MazG-like
Other DBs
NCBI-GeneID: 936515
NCBI-ProteinID: NP_391345
Pasteur: BG12412
BSORF: BG12412
UniProt: O32263 A0A6M4JPF5
Position
3559632..3559952
AA seq 106 aa
MQLADAEKWMKEFYEKRGWTEYGPFIRVGFLMEEAGELARAVRAYEIGRDRPDEKESSRA
EQKQELIEEMGDVIGNIAILADMYGVSLEDVMKAHQEKLTKRFEHA
NT seq 321 nt   +upstreamnt  +downstreamnt
ttgcagctggctgatgcagaaaaatggatgaaagagttttacgaaaaaagaggctggaca
gaatacggaccttttattcgcgtcggctttttaatggaggaagccggagaactggcccgg
gctgtcagggcgtatgaaatcggcagagaccggccggatgagaaagaatcgtcacgcgct
gagcaaaaacaagaattgattgaagaaatgggagatgtcatcggaaatatcgccattctt
gctgatatgtatggtgtctctttagaagacgtcatgaaggcccaccaagaaaaactgaca
aaacgatttgagcatgcataa

DBGET integrated database retrieval system