KEGG   Bacillus subtilis subsp. subtilis 168: BSU34650Help
Entry
BSU34650          CDS       T00010                                 

Gene name
yvdC
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MazG MazG-like PRA-PH
Motif
Other DBs
NCBI-GeneID: 936515
NCBI-ProteinID: NP_391345
Pasteur: BG12412
BSORF: BG12412
UniProt: O32263
Position
3559632..3559952
Genome map
AA seq 106 aa AA seqDB search
MQLADAEKWMKEFYEKRGWTEYGPFIRVGFLMEEAGELARAVRAYEIGRDRPDEKESSRA
EQKQELIEEMGDVIGNIAILADMYGVSLEDVMKAHQEKLTKRFEHA
NT seq 321 nt NT seq  +upstreamnt  +downstreamnt
ttgcagctggctgatgcagaaaaatggatgaaagagttttacgaaaaaagaggctggaca
gaatacggaccttttattcgcgtcggctttttaatggaggaagccggagaactggcccgg
gctgtcagggcgtatgaaatcggcagagaccggccggatgagaaagaatcgtcacgcgct
gagcaaaaacaagaattgattgaagaaatgggagatgtcatcggaaatatcgccattctt
gctgatatgtatggtgtctctttagaagacgtcatgaaggcccaccaagaaaaactgaca
aaacgatttgagcatgcataa

DBGET integrated database retrieval system