KEGG   Bacillus subtilis subsp. subtilis 168: BSU34660Help
Entry
BSU34660          CDS       T00010                                 

Gene name
yvdB
Definition
(RefSeq) sulfate transporter YvdB
  KO
K03321  sulfate permease, SulP family
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU34660 (yvdB)
Transporters [BR:bsu02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   BSU34660 (yvdB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sulfate_transp STAS STAS_2 MFS_MOT1 DUF4083 QCR10
Motif
Other DBs
NCBI-GeneID: 937217
NCBI-ProteinID: NP_391346
Pasteur: BG12411
BSORF: BG12411
UniProt: O06984
Position
complement(3559979..3561571)
Genome map
AA seq 530 aa AA seqDB search
MRFSGRFKGYNLQKFQKDLIAGIVVGVVAIPLGMAFAIASGVEPEYGLYTVVIAGICISL
FGGSKYQIGGPTGAFVPILFGIIMQYGLENLLIAGFMAGVMLVLFGLFKLGKIMKFVPKP
VIVGFTAGIAVLIFTEQIANFLGLRNVEKHENFHHNMFEIVQQLGTFNVYAILTAVIGLV
ILLVSAKVMPKVPGALLALLISTVVAVVFFPDRMATIGSTYGEIPRHLPEFQFPELTLDK
MVMLFPAALVIALLGGLESILSAMVADNMKGSKHDSNKELVGQGIANMAAPLFGGIPATG
AIARTATNIKNGAVSPVSGVVHGVVVLLVLLVFAPYASHVPLASMAPILMVVAWNMSERK
EVANMLRLKNADSFILAATFALTVLFDLIIGVATGLLLAFVFFIRRMSEATRIHNQETHP
VLAKREDPSVSMYAIEGPLFFGSIDSLESSLLEHVQKKPKTLILLMNKVHYMDTSAEAVL
GNIMNRIKRHNGKLMIVGLQSQPKELLHKTGLFHKIGKQHFFDHHDEITG
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgcgattctcagggagattcaagggatacaatttgcagaaatttcagaaagacttgatt
gcaggtatcgtagtaggtgtcgtggcaattcctttaggaatggcgtttgccattgcctcg
ggagtcgagcctgaatatgggctatacactgttgttatagcagggatttgtatttctttg
tttggaggatcaaaatatcagattggcggtccgacgggcgcctttgtcccgattttattc
ggcattatcatgcagtacggcttggaaaatctgctgattgcggggtttatggcaggagtg
atgctggtactgtttgggctgtttaagctcggaaaaataatgaaattcgtgcccaaaccc
gttatcgtcggttttacagccggaattgccgtgctgatctttacggaacaaatcgctaat
tttctcggattgagaaatgttgaaaaacatgagaactttcatcacaacatgtttgaaatt
gtgcagcagctcggcacctttaacgtgtatgccattttgacagctgtgatcgggctcgtc
attttgcttgtatccgccaaggtgatgcctaaagtgccgggcgctttgttggcgcttctt
atttccacagtggtcgcggttgtctttttccctgaccgcatggcaacgatcgggtcaact
tatggagaaatcccccgccatttgccggaatttcagtttcctgagcttactttggataaa
atggttatgctgtttccggctgcgcttgtcatcgcgcttcttggaggacttgagtcgatt
ttgtccgcaatggtcgctgataacatgaagggctcaaagcatgacagcaacaaggagctt
gtcggccaggggattgcgaatatggcagcgcccctgtttggcggaatcccggctacagga
gcgattgcgagaacggcgaccaatataaaaaacggagcggtttccccagtttccggcgtc
gttcacggcgtagtcgttctccttgtcctgcttgtatttgcgccttatgcgtcccatgtg
ccgctcgccagtatggcaccgattctcatggtggtcgcatggaatatgagtgagcgcaag
gaagtcgcaaacatgctgagactgaaaaatgctgattcctttattttggcggcgaccttc
gcccttacggttctgtttgacttaatcatcggtgtggcaaccggattgctgcttgcattc
gtgttctttatcagaagaatgagcgaagcgacccgcatccacaatcaggaaacgcatcct
gttctggcgaagagagaagatccatctgtcagcatgtatgccatagaagggccgctgttt
ttcggatcaattgattcccttgaatcgtcattgctggagcatgtacagaaaaaaccgaaa
acccttattctgctcatgaataaggtgcactatatggatacgtcagctgaagcggtgctt
gggaacattatgaatcgaattaaacgccacaatggaaagctgatgattgtaggattgcaa
tcgcagccgaaggagctactgcataaaacaggcctttttcacaaaataggaaagcagcat
ttctttgatcaccatgatgaaatcacaggttaa

DBGET integrated database retrieval system