KEGG   Bacillus subtilis subsp. subtilis 168: BSU34670Help
Entry
BSU34670          CDS       T00010                                 

Gene name
yvdA
Definition
(RefSeq) carbonic anhydrase YvdA
  KO
K01673  carbonic anhydrase [EC:4.2.1.1]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00910  Nitrogen metabolism
bsu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    BSU34670 (yvdA)
Enzymes [BR:bsu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.1  carbonic anhydrase
     BSU34670 (yvdA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pro_CA
Motif
Other DBs
NCBI-GeneID: 937999
NCBI-ProteinID: NP_391347
Pasteur: BG12410
BSORF: BG12410
UniProt: O06983
Position
complement(3561590..3562183)
Genome map
AA seq 197 aa AA seqDB search
MNQMVSLTSILEHNQRFVSEKKYEPYKTTKFPSKKLVIVTCMDTRLTELLPQAMGLKNGD
AKIVKNAGAIVSHPFGSVMRSILVAIYELQAEEVCIVGHHECGMSGLNASSILEKAKERG
VEDSCLNLLTSAGLDLKTWLTGFHSVEESVSHSVNMIKNHPLLPKKVPVHGLVIHPETGK
LDVVINGYETELINNHS
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaaatggtttctttaacatcaattttggaacacaatcagcggtttgtcagtgag
aagaagtatgaaccgtacaaaacgacaaagtttccttcgaaaaagctcgtcattgtcacc
tgtatggatacaaggcttacagaacttcttccgcaagcaatggggcttaaaaacggtgat
gctaaaattgtaaaaaacgcgggagccatcgtttctcacccatttggaagcgtgatgcga
agcatactggtcgcgatttatgaattgcaggctgaagaggtatgcattgtcggccatcat
gaatgcggaatgtcagggctgaatgcgtcctcgattcttgagaaagcaaaggaacgcggg
gtggaggatagctgcctgaatttgctgacgagtgccggactcgatttgaaaacgtggctg
actggttttcacagcgtggaagaaagcgtttcccacagtgtgaacatgattaagaaccat
ccgctgcttccgaaaaaagtgccggttcacgggcttgtcattcaccctgaaacaggaaaa
cttgatgtggtcattaacggttatgaaactgagcttataaacaatcactcataa

DBGET integrated database retrieval system