KEGG   Bacillus subtilis subsp. subtilis 168: BSU34680Help
Entry
BSU34680          CDS       T00010                                 

Gene name
yvcT
Definition
(RefSeq) 2-ketogluconate reductase
  KO
K00090  glyoxylate/hydroxypyruvate/2-ketogluconate reductase [EC:1.1.1.79 1.1.1.81 1.1.1.215]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00030  Pentose phosphate pathway
bsu00260  Glycine, serine and threonine metabolism
bsu00620  Pyruvate metabolism
bsu00630  Glyoxylate and dicarboxylate metabolism
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BSU34680 (yvcT)
   00620 Pyruvate metabolism
    BSU34680 (yvcT)
   00630 Glyoxylate and dicarboxylate metabolism
    BSU34680 (yvcT)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BSU34680 (yvcT)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.79  glyoxylate reductase (NADP+)
     BSU34680 (yvcT)
    1.1.1.81  hydroxypyruvate reductase
     BSU34680 (yvcT)
    1.1.1.215  gluconate 2-dehydrogenase
     BSU34680 (yvcT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh NAD_binding_2 IlvN F420_oxidored
Motif
Other DBs
NCBI-GeneID: 936519
NCBI-ProteinID: NP_391348
Pasteur: BG12409
BSORF: BG12409
UniProt: O32264
Position
3562566..3563543
Genome map
AA seq 325 aa AA seqDB search
MLKPFVFITKPIPEEIEAFIGEHCRYEVWQEDTLPSDVLFEKLKEAEGLLTSGTSGPSIN
RELLEHAPKLKVVSNQSVGYDNFDIEAMKERGVVGTHTPYTLDDTVADLAFSLILSSARR
VAELDRFVRAGKWGTVEEEALFGIDVHHQTLGIIGMGRIGEQAARRAKFGFDMEVLYHNR
HRKQETEDSIGVKYAELDTLLEQSDFILLITPLTDETYHMIGEREFKLMKNSAIFVNISR
GKTVDEKALIRALQEGWIRGAGLDVYEKEPVTQDNPLLQLDNVTLLPHIGSATAKVRFNM
CKQAAENMLAAIQGQTPKNLTREFQ
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
ttgttgaaaccatttgtatttatcacaaaaccgattcctgaagagattgaagcattcatc
ggtgaacattgccgttatgaagtatggcaggaggatacgcttccgagtgacgtgctattt
gaaaaattaaaagaagcggaggggcttttaacatcagggacgtccggaccgtcaatcaat
cgtgagttgctggaacacgcgcctaagctcaaagtggtcagcaaccaatcagtaggctac
gataacttcgatatagaagcaatgaaagaaagaggagtcgtcgggactcatacaccttat
acactggatgacacagttgcagatctggctttttcactgattctgtcttccgccagacgt
gttgccgaactggaccgttttgtcagagcaggaaaatggggaaccgtggaagaggaagcg
cttttcggaattgatgttcatcatcaaacgttaggcattatcggcatgggcagaattgga
gaacaagcagcgagacgcgccaaatttggttttgatatggaagtgctttatcataaccga
catcgcaaacaagaaacagaagacagcatcggcgttaagtatgcagagcttgatacattg
ctggagcaatctgattttattcttctcattacgccgctgactgatgaaacctatcacatg
ataggagaacgcgaatttaagttgatgaagaattcagcaattttcgtcaatatttcccgg
ggaaagacagttgatgaaaaagcactgattcgcgctcttcaggaaggctggatcagggga
gccggcttagatgtatacgaaaaagagcctgtcacccaagataatccgctcctgcagctg
gataatgtcacgctgcttcctcatatcggttcagcaacagctaaagtgcgcttcaacatg
tgcaaacaggccgccgaaaatatgctcgcagcgatccaagggcaaacaccgaaaaatctt
acaagagaatttcaataa

DBGET integrated database retrieval system