KEGG   Bacillus subtilis subsp. subtilis 168: BSU34690
Entry
BSU34690          CDS       T00010                                 

Symbol
yvcS
Name
(RefSeq) ABC transporter permease
  KO
K02004  putative ABC transport system permease protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU34690 (yvcS)
Transporters [BR:bsu02000]
 ABC transporters, prokaryotic type
  ABC-2 type and other transporters
   Putative ABC transporter
    BSU34690 (yvcS)
SSDB
Motif
Pfam: FtsX
Other DBs
NCBI-GeneID: 938473
NCBI-ProteinID: NP_391349
Pasteur: BG12408
BSORF: BG12408
UniProt: O06981 A0A6M4JPG5
Position
complement(3563581..3565521)
AA seq 646 aa
MNLRTIARKNILGNLQRYVAYFLSCVFAVSVFFVFTSFIFHPDVNEDNIYGGSLVKTCLS
AALVVIIVFCIFFITYSNSAFLQARKKEFGLLTLFGTSKQQLRKMIYYEQSLISLAAIAA
GIGAGLLFSKLFFMIMTWMLSVKVPISFAIVPKAFVMTIAGFLILFQTLLILSLGRIRKL
EIIELIKSAKKPKSLPVYSKWLTVLSLLCLGSGYYLSATANAIDMMFRVFPILILVLIGT
YFFFTQSSVAFFRMLYRKKHSFYKGTNIIVRSNMIFRLKDHARMLFLTSVITAVILTATG
VIYMFYSDLQRQEEQSIPQSVSWVEKDASRFQVMKPETAENTLKKAHAVITYKVDATGIP
VTFQSDLPYGNKKMEAEALLISEKVYNQVAKEKGFPVIHLQENEAFINVSFQMMVKDTFG
EGETAAFHMKSGKTLSYVMKKQQNKGILMSVDGVSRLLVVSEKSFDSLSQDVPLKEQMRM
VGYELEHWQETVDVSEKLENMVPKEHTSDFQTRAPSYQIVKQGVALMLFIGLFVSVLFFI
VQGSMLYLRMFTEIEDTGVQVLALKRIGVTDKEIHSILGKQIGFLFFIPFIAGTIHAGFA
YAALSNMLNSNLFLEAVIVIFIYFVFQALYYIVTRHIYKRAVLQRM
NT seq 1941 nt   +upstreamnt  +downstreamnt
atgaatttgagaactatcgcccgtaaaaacattcttgggaatctgcaacggtatgtggcc
tactttttaagctgtgtgtttgccgtttcggtgttttttgtcttcacatcatttattttt
catcctgatgtcaatgaagacaatatatatggaggaagccttgtcaaaacatgcttgagc
gcagctcttgtcgtcatcattgtgttttgtatatttttcatcacatattccaattcagcg
tttttgcaggcaagaaagaaagagtttgggctgctgacactgtttggcacatcaaagcag
cagcttcgcaagatgatttattatgagcagtcacttatttctcttgcggcgattgcggcc
ggcattggagcaggcctgttattttcaaaactgttttttatgatcatgacatggatgctc
agcgtgaaggtgccgatttcgtttgccattgtgccgaaagcgtttgtgatgacaattgcc
ggctttctcatcctgtttcagacgctgctcattttatcactgggacggattcggaagctg
gaaatcattgaactgattaaatcagccaaaaagccgaaaagtttgccagtttattcgaaa
tggctcactgtattgtctttgctatgtcttggcagcggttattatctatctgcaacagcc
aatgcaattgacatgatgtttcgggtttttccaattttgattttagtgttaattggcacg
tatttcttttttacccaaagcagtgtggcatttttccgcatgctgtaccgaaagaaacac
agcttctacaaaggcacaaatatcattgtgcgttccaacatgatattcaggctgaaggat
catgcacgcatgctgtttttaacctctgtcattacagcggtcatactaacagctacaggt
gtcatctatatgttttattccgatttacaaaggcaggaggagcaaagcattcctcagtct
gtttcctgggtggaaaaggatgcttcccgctttcaggtcatgaagcctgagacggctgag
aatacattgaaaaaagctcatgctgttatcacgtataaggtggatgccacagggattcct
gtcacttttcagtcagacttgccgtatggaaataagaagatggaagctgaagctttgctg
atttcagaaaaagtctataatcaagtcgcaaaggaaaaagggttcccagttattcattta
caagaaaatgaagcatttattaatgtttcttttcaaatgatggtgaaagacacatttgga
gaaggggaaacagcagcatttcatatgaagtcaggaaaaaccctttcctatgtcatgaaa
aagcagcaaaacaaagggatattgatgtctgtcgatggagtcagccgtttattggttgtc
agcgaaaagagctttgacagtctgtcacaggatgtgccgctgaaggaacagatgagaatg
gtaggttatgagcttgagcattggcaggagacggtggatgtctctgaaaagcttgaaaac
atggtgccgaaagaacatacatctgattttcaaacacgtgctcctagttatcaaattgtg
aagcagggagttgcattaatgctgtttattggtctgtttgtcagcgtgctgttttttatc
gtgcaaggaagcatgctgtatttgcggatgtttacggaaatagaagatacgggagtgcag
gtgttagcgttaaagaggataggggttacggacaaagagattcactcgatccttggaaag
caaataggatttttattcttcatcccatttatcgcaggtacgattcacgcgggctttgcg
tatgcagcgttaagtaatatgctgaattccaatttatttcttgaggccgtaattgtcatc
ttcatttattttgtattccaggctctttattatatcgtcacccgtcatatttataagcgt
gctgttcttcagcgtatgtaa

DBGET integrated database retrieval system