KEGG   Bacillus subtilis subsp. subtilis 168: BSU34690Help
Entry
BSU34690          CDS       T00010                                 

Gene name
yvcS
Definition
(RefSeq) ABC transporter permease
  KO
K02004  putative ABC transport system permease protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Module
bsu_M00258  Putative ABC transport system
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU34690 (yvcS)
Transporters [BR:bsu02000]
 ABC Transporters, Prokaryotic Type
  ABC-2 type and other transporters
   Putative ABC transporter [MD:M00258]
    BSU34690 (yvcS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FtsX
Motif
Other DBs
NCBI-GeneID: 938473
NCBI-ProteinID: NP_391349
Pasteur: BG12408
BSORF: BG12408
UniProt: O06981
Position
complement(3563581..3565521)
Genome map
AA seq 646 aa AA seqDB search
MNLRTIARKNILGNLQRYVAYFLSCVFAVSVFFVFTSFIFHPDVNEDNIYGGSLVKTCLS
AALVVIIVFCIFFITYSNSAFLQARKKEFGLLTLFGTSKQQLRKMIYYEQSLISLAAIAA
GIGAGLLFSKLFFMIMTWMLSVKVPISFAIVPKAFVMTIAGFLILFQTLLILSLGRIRKL
EIIELIKSAKKPKSLPVYSKWLTVLSLLCLGSGYYLSATANAIDMMFRVFPILILVLIGT
YFFFTQSSVAFFRMLYRKKHSFYKGTNIIVRSNMIFRLKDHARMLFLTSVITAVILTATG
VIYMFYSDLQRQEEQSIPQSVSWVEKDASRFQVMKPETAENTLKKAHAVITYKVDATGIP
VTFQSDLPYGNKKMEAEALLISEKVYNQVAKEKGFPVIHLQENEAFINVSFQMMVKDTFG
EGETAAFHMKSGKTLSYVMKKQQNKGILMSVDGVSRLLVVSEKSFDSLSQDVPLKEQMRM
VGYELEHWQETVDVSEKLENMVPKEHTSDFQTRAPSYQIVKQGVALMLFIGLFVSVLFFI
VQGSMLYLRMFTEIEDTGVQVLALKRIGVTDKEIHSILGKQIGFLFFIPFIAGTIHAGFA
YAALSNMLNSNLFLEAVIVIFIYFVFQALYYIVTRHIYKRAVLQRM
NT seq 1941 nt NT seq  +upstreamnt  +downstreamnt
atgaatttgagaactatcgcccgtaaaaacattcttgggaatctgcaacggtatgtggcc
tactttttaagctgtgtgtttgccgtttcggtgttttttgtcttcacatcatttattttt
catcctgatgtcaatgaagacaatatatatggaggaagccttgtcaaaacatgcttgagc
gcagctcttgtcgtcatcattgtgttttgtatatttttcatcacatattccaattcagcg
tttttgcaggcaagaaagaaagagtttgggctgctgacactgtttggcacatcaaagcag
cagcttcgcaagatgatttattatgagcagtcacttatttctcttgcggcgattgcggcc
ggcattggagcaggcctgttattttcaaaactgttttttatgatcatgacatggatgctc
agcgtgaaggtgccgatttcgtttgccattgtgccgaaagcgtttgtgatgacaattgcc
ggctttctcatcctgtttcagacgctgctcattttatcactgggacggattcggaagctg
gaaatcattgaactgattaaatcagccaaaaagccgaaaagtttgccagtttattcgaaa
tggctcactgtattgtctttgctatgtcttggcagcggttattatctatctgcaacagcc
aatgcaattgacatgatgtttcgggtttttccaattttgattttagtgttaattggcacg
tatttcttttttacccaaagcagtgtggcatttttccgcatgctgtaccgaaagaaacac
agcttctacaaaggcacaaatatcattgtgcgttccaacatgatattcaggctgaaggat
catgcacgcatgctgtttttaacctctgtcattacagcggtcatactaacagctacaggt
gtcatctatatgttttattccgatttacaaaggcaggaggagcaaagcattcctcagtct
gtttcctgggtggaaaaggatgcttcccgctttcaggtcatgaagcctgagacggctgag
aatacattgaaaaaagctcatgctgttatcacgtataaggtggatgccacagggattcct
gtcacttttcagtcagacttgccgtatggaaataagaagatggaagctgaagctttgctg
atttcagaaaaagtctataatcaagtcgcaaaggaaaaagggttcccagttattcattta
caagaaaatgaagcatttattaatgtttcttttcaaatgatggtgaaagacacatttgga
gaaggggaaacagcagcatttcatatgaagtcaggaaaaaccctttcctatgtcatgaaa
aagcagcaaaacaaagggatattgatgtctgtcgatggagtcagccgtttattggttgtc
agcgaaaagagctttgacagtctgtcacaggatgtgccgctgaaggaacagatgagaatg
gtaggttatgagcttgagcattggcaggagacggtggatgtctctgaaaagcttgaaaac
atggtgccgaaagaacatacatctgattttcaaacacgtgctcctagttatcaaattgtg
aagcagggagttgcattaatgctgtttattggtctgtttgtcagcgtgctgttttttatc
gtgcaaggaagcatgctgtatttgcggatgtttacggaaatagaagatacgggagtgcag
gtgttagcgttaaagaggataggggttacggacaaagagattcactcgatccttggaaag
caaataggatttttattcttcatcccatttatcgcaggtacgattcacgcgggctttgcg
tatgcagcgttaagtaatatgctgaattccaatttatttcttgaggccgtaattgtcatc
ttcatttattttgtattccaggctctttattatatcgtcacccgtcatatttataagcgt
gctgttcttcagcgtatgtaa

DBGET integrated database retrieval system