KEGG   Bacillus subtilis subsp. subtilis 168: BSU34700
Entry
BSU34700          CDS       T00010                                 

Symbol
yvcR
Name
(RefSeq) ABC transporter ATP-binding protein
  KO
K02003  putative ABC transport system ATP-binding protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU34700 (yvcR)
Transporters [BR:bsu02000]
 ABC transporters, prokaryotic type
  ABC-2 type and other transporters
   Putative ABC transporter
    BSU34700 (yvcR)
SSDB
Motif
Pfam: ABC_tran AAA_21 AAA_16 SMC_N AAA_25 AAA_30 AAA_22 RsgA_GTPase AAA_29 MMR_HSR1 Rad17 cobW AAA_23 AAA_28 AAA_18 SRPRB AAA_33 DO-GTPase2 Mg_chelatase T2SSE AAA_14 MobB NB-ARC AAA_24 AAA_7
Other DBs
NCBI-GeneID: 936524
NCBI-ProteinID: NP_391350
Pasteur: BG12407
BSORF: BG12407
UniProt: O06980 A0A6M3ZHA9
Position
complement(3565496..3566275)
AA seq 259 aa
MNVLQTTNLSKTYYSNKGTISYQALSAFDLSVSKGEFVGIMGPSGSGKTTLLNLLATIDK
PTQGEMMINGIQPKTLKDQELALFRRRELGFVFQDFNLLDTLTIRENILLPLALDKVKLR
EMEARLDELADTLQIKHILDHRTYEVSGGQQQRAACARAIIHNPALILADEPTGNLDSKS
AKQVMNTLAQLNEEKEATILLVTHDATAASFCKRIVFIKDGRFFSEIHRGTNRQVFYQSI
LDTLSVLGGDFHEFENYRP
NT seq 780 nt   +upstreamnt  +downstreamnt
atgaacgtgttgcaaacaacgaacctatcgaaaacatactattcaaataaaggaacaata
tcataccaagcgctcagcgcctttgatctcagtgtgtcaaaaggagaatttgtcgggatt
atggggccgtcgggaagcggaaaaaccacgcttttgaatttgctggctaccattgataag
ccgacccagggcgagatgatgatcaacggcattcagccgaaaacgttaaaggaccaagag
ctggctttgtttcgcagaagagaactcggcttcgtctttcaggattttaatctgcttgat
acgctgacgattcgtgaaaatattctcttgccgctcgcattggataaggtaaagctgaga
gaaatggaagctcgattggatgaactggcggatacgctgcaaataaagcatattctcgat
caccgcacatatgaggtgtcgggcggacagcagcagcgggcagcttgtgccagagcgatt
attcacaatccggcgctcattcttgccgatgaaccgacaggaaacctcgactcaaaatcg
gcaaagcaagtgatgaacacactggctcagctgaatgaggaaaaggaagcgacgattttg
ttggttacgcatgatgccacagcagcaagtttctgtaaacggattgtttttattaaagac
ggacgtttcttttcagagattcacagaggaacaaacaggcaggtgttttatcaaagtata
ttggataccttgagtgtgttgggaggcgattttcatgaatttgagaactatcgcccgtaa

DBGET integrated database retrieval system