KEGG   Bacillus subtilis subsp. subtilis 168: BSU34700Help
Entry
BSU34700          CDS       T00010                                 

Gene name
yvcR
Definition
(RefSeq) ABC transporter ATP-binding protein
  KO
K02003  putative ABC transport system ATP-binding protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Module
bsu_M00258  Putative ABC transport system
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU34700 (yvcR)
Transporters [BR:bsu02000]
 ABC Transporters, Prokaryotic Type
  ABC-2 type and other transporters
   Putative ABC transporter [MD:M00258]
    BSU34700 (yvcR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_16 AAA_25 AAA_22 RsgA_GTPase AAA_30 AAA_29 MMR_HSR1 Rad17 cobW AAA_23 AAA_28 T2SSE SRPRB AAA_18 AAA_33 SbcCD_C Mg_chelatase AAA_7 AAA_24 AAA_14 NB-ARC
Motif
Other DBs
NCBI-GeneID: 936524
NCBI-ProteinID: NP_391350
Pasteur: BG12407
BSORF: BG12407
UniProt: O06980
Position
complement(3565496..3566275)
Genome map
AA seq 259 aa AA seqDB search
MNVLQTTNLSKTYYSNKGTISYQALSAFDLSVSKGEFVGIMGPSGSGKTTLLNLLATIDK
PTQGEMMINGIQPKTLKDQELALFRRRELGFVFQDFNLLDTLTIRENILLPLALDKVKLR
EMEARLDELADTLQIKHILDHRTYEVSGGQQQRAACARAIIHNPALILADEPTGNLDSKS
AKQVMNTLAQLNEEKEATILLVTHDATAASFCKRIVFIKDGRFFSEIHRGTNRQVFYQSI
LDTLSVLGGDFHEFENYRP
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgaacgtgttgcaaacaacgaacctatcgaaaacatactattcaaataaaggaacaata
tcataccaagcgctcagcgcctttgatctcagtgtgtcaaaaggagaatttgtcgggatt
atggggccgtcgggaagcggaaaaaccacgcttttgaatttgctggctaccattgataag
ccgacccagggcgagatgatgatcaacggcattcagccgaaaacgttaaaggaccaagag
ctggctttgtttcgcagaagagaactcggcttcgtctttcaggattttaatctgcttgat
acgctgacgattcgtgaaaatattctcttgccgctcgcattggataaggtaaagctgaga
gaaatggaagctcgattggatgaactggcggatacgctgcaaataaagcatattctcgat
caccgcacatatgaggtgtcgggcggacagcagcagcgggcagcttgtgccagagcgatt
attcacaatccggcgctcattcttgccgatgaaccgacaggaaacctcgactcaaaatcg
gcaaagcaagtgatgaacacactggctcagctgaatgaggaaaaggaagcgacgattttg
ttggttacgcatgatgccacagcagcaagtttctgtaaacggattgtttttattaaagac
ggacgtttcttttcagagattcacagaggaacaaacaggcaggtgttttatcaaagtata
ttggataccttgagtgtgttgggaggcgattttcatgaatttgagaactatcgcccgtaa

DBGET integrated database retrieval system