KEGG   Bacillus subtilis subsp. subtilis 168: BSU34720Help
Entry
BSU34720          CDS       T00010                                 

Gene name
yvcP
Definition
(RefSeq) transcriptional regulator
  KO
K02483  two-component system, OmpR family, response regulator
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:bsu02022]
    BSU34720 (yvcP)
Two-component system [BR:bsu02022]
 OmpR family
  Unclassified
   BSU34720 (yvcP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trans_reg_C Response_reg
Motif
Other DBs
NCBI-GeneID: 936531
NCBI-ProteinID: NP_391352
Pasteur: BG12405
BSORF: BG12405
UniProt: O06978
Position
complement(3567422..3568135)
Genome map
AA seq 237 aa AA seqDB search
MYRILLVEDDERIASLLGGHLQKYGYEVKIAEQLNDIKLEFAEMKPDLVLLDINLPFFDG
FYWCRQIRTISNAPIIFISARTDELNQVMAIENGGDDYITKPFHLEVVMAKIKSVLRRTY
GEYSPSLPQESRIVELGGLTIYPDQNEAEWNSVRILFSQKEFQLLSIFVREHKKIVSRDE
LLEALWDDVDFVDDNTLTVNVNRLRRKLENAGLTDCISTIRGQGYQFQVNRKDEAEC
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
gtgtatcggattttgcttgtggaagatgatgagcggattgcttctttgctgggcggtcat
cttcaaaaatacggatatgaagtgaaaattgctgaacagctgaatgatataaaattggaa
tttgcagaaatgaagcctgatcttgtgctgcttgatatcaacctgcctttttttgacggg
ttttattggtgcaggcaaatccgtaccatttccaatgcgccgattatctttatatcggca
cggaccgatgagctgaatcaggtaatggcgattgaaaatggcggcgatgattatatcaca
aagccgttccatctagaggtagtgatggccaaaatcaaaagcgtcctgcgccgcacatat
ggtgaatattcgccctctttgccgcaggaatctagaatagtggagcttggcgggctgacg
atttatcctgatcagaatgaggccgaatggaacagcgtccggattttgttttcccaaaaa
gaattccagcttctctcgatttttgtgagggagcataaaaaaattgtctctcgtgatgaa
ctattggaggcgttatgggatgacgttgattttgtcgatgacaatacgttaacggtcaat
gtcaatcggctgcggagaaaactggagaatgcaggactgacagattgcatttccacaatc
agaggacaaggttatcaatttcaagtcaatcggaaggatgaagcggaatgttaa

DBGET integrated database retrieval system