KEGG   Bacillus subtilis subsp. subtilis 168: BSU34729Help
Entry
BSU34729          CDS       T00010                                 

Gene name
yvzJ
Definition
(RefSeq) lipoprotein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LPAM_1
Motif
Other DBs
NCBI-GeneID: 8303070
NCBI-ProteinID: YP_003097790
UniProt: C0H3R7
Position
3568282..3568491
Genome map
AA seq 69 aa AA seqDB search
MKKIMLFLAMTSILSACQPNYTGKYIEIGDTLTDYTKECFKENEIPYKYEKGKLYIPEDA
FDTAIYTCS
NT seq 210 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaatcatgctgtttctggcaatgacgtcaattctttcagcatgtcagcccaac
tataccgggaaatacatagaaattggggatacactaactgactataccaaagagtgcttt
aaagagaatgaaattccttataaatacgaaaagggaaaactgtatatcccagaagacgca
tttgatacagcaatctacacttgttcataa

DBGET integrated database retrieval system