KEGG   Bacillus subtilis subsp. subtilis 168: BSU34730Help
Entry
BSU34730          CDS       T00010                                 

Gene name
yvcN
Definition
(RefSeq) acetyltransferase YvcN
  KO
K00675  N-hydroxyarylamine O-acetyltransferase [EC:2.3.1.118]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BSU34730 (yvcN)
Enzymes [BR:bsu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.118  N-hydroxyarylamine O-acetyltransferase
     BSU34730 (yvcN)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetyltransf_2 Transglut_core
Motif
Other DBs
NCBI-GeneID: 936525
NCBI-ProteinID: NP_391353
Pasteur: BG12404
BSORF: BG12404
UniProt: O06977
Position
complement(3568527..3569291)
Genome map
AA seq 254 aa AA seqDB search
MIKMSDFLKDCFQKIGWEKDHVSFGDLPLFLKAMAYRFPFENRAVLAKENYKITKEELWR
RLLKDQHGGLCYDLNGFLYFVLREAGFHVKLIRGTVYAGDQEGWALEGTHAAVWLSAENG
DYLVDIGFGINLALQPIPLSGETVQSPVGSFRIKKEETEKGSYVLLMDKGEGWQIGYAFT
LEESDLGDLDNMKDIIHSHEKSPFNKSLLASKLTPSGRMVMSERHFTIYENGGNIQKSDI
GPSGFEEKLNTHFL
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
gtgataaaaatgagtgactttctaaaagactgctttcagaaaatcggctgggagaaagac
catgtcagcttcggcgatcttcccctttttcttaaagcaatggcataccgttttccattc
gaaaaccgtgccgtacttgcaaaagagaattataagatcacaaaagaagagctatggcga
cgtctgctcaaagatcagcacggcggcctatgctacgatctaaatggtttcctttatttt
gtcttgcgtgaggccgggtttcatgtgaagctcattcgaggaacggtttatgcaggcgat
caagagggatgggcactagaagggacgcatgctgctgtatggctgtctgcggaaaacggc
gattacctcgttgatatcggcttcggcatcaacctggcgctccagccgataccgctttcc
ggagaaacggtacagtcaccagtcgggtcattccgaatcaaaaaggaagagacagaaaag
ggcagctatgttctgctgatggacaaaggagaaggctggcaaattgggtacgcctttacc
cttgaagagagtgatctcggtgatttagataacatgaaggacatcattcactctcatgaa
aaatctccttttaacaaatccctgcttgcctcaaagctgacgccgagcggaaggatggtc
atgtcagagcgccattttacgatttatgaaaacggcggtaacattcaaaaaagcgacatc
ggcccttcaggatttgaagagaaattaaatactcattttttgtaa

DBGET integrated database retrieval system