KEGG   Bacillus subtilis subsp. subtilis 168: BSU34740Help
Entry
BSU34740          CDS       T00010                                 

Gene name
crh
Definition
(RefSeq) HPr-like protein Crh
  KO
K11184  catabolite repression HPr-like protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99981 Carbohydrate metabolism
    BSU34740 (crh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PTS-HPr
Motif
Other DBs
NCBI-GeneID: 938474
NCBI-ProteinID: NP_391354
Pasteur: BG12403
BSORF: BG12403
UniProt: O06976
Structure
PDB: 

Position
complement(3569292..3569549)
Genome map
AA seq 85 aa AA seqDB search
MVQQKVEVRLKTGLQARPAALFVQEANRFTSDVFLEKDGKKVNAKSIMGLMSLAVSTGTE
VTLIAQGEDEQEALEKLAAYVQEEV
NT seq 258 nt NT seq  +upstreamnt  +downstreamnt
atggttcaacagaaagtggaagttcgattaaagacaggactgcaagcacgtcctgctgct
ttgtttgtacaagaagcaaaccggtttacgtcagatgtgtttcttgagaaggatgggaaa
aaagtaaacgccaaaagcatcatggggctgatgagccttgcggtaagcacaggcactgag
gttaccttgattgcccagggagaagatgaacaagaggcgctggagaagctggctgcttac
gttcaagaagaagtttag

DBGET integrated database retrieval system