KEGG   Bacillus subtilis subsp. subtilis 168: BSU34750Help
Entry
BSU34750          CDS       T00010                                 

Gene name
whiA
Definition
(RefSeq) sporulation transcription regulator WhiA
  KO
K09762  uncharacterized protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    BSU34750 (whiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LAGLIDADG_WhiA HTH_WhiA WhiA_N Sigma70_r4 LAGLIDADG_3 DUF3486 Ribosomal_L14
Motif
Other DBs
NCBI-GeneID: 936540
NCBI-ProteinID: NP_391355
Pasteur: BG12402
BSORF: BG12402
UniProt: O06975
Position
complement(3569573..3570523)
Genome map
AA seq 316 aa AA seqDB search
MSFASETKKELTNLEVKDCCINAELSALIRMNGALSFTNRHLVLDVQTENAAIARRIYTL
LKKQYDVSVELLVRKKMRLKKNNVYIVRFSENAKAILEDLKILGENFVFERSISKELVKK
RCCKRSYMRGAFLAGGSVNNPETSSYHLEIFSLYKEHNDSLCDLLNEFQLNSKTLERKKG
YITYLKEAEKITEFLNVIGAHNSLLRFEDVRIVRDMRNSVNRLVNCETANLNKTIGASLR
QVENIKYIDERIGLEALPEKLREIAQLRIDYQEVTLKELGEMVASGKISKSGINHRLRKL
DEIAEQLRTGQTVTLK
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgtcatttgcatcagaaacaaaaaaagaattaacgaatctggaagtgaaggactgctgc
attaatgccgagctgtctgcactcattcggatgaatggagctttatcatttacaaaccgc
catctcgtactcgatgttcaaaccgaaaacgcggcgattgcccgccgcatctatacattg
ctgaaaaaacaatatgatgtgtcggtcgagctgctggtcagaaagaaaatgcggctgaaa
aagaataacgtctatattgtgcgtttttcagaaaatgcaaaagcgatcttagaggattta
aaaatactcggggagaattttgtgtttgaacgaagtatttcgaaagagctggtcaaaaag
agatgctgcaagcgttcttatatgagaggagcatttttggcaggaggttcggtcaataac
ccggaaacctcctcgtatcatttagaaatcttctctctttataaggagcataacgattca
ttatgtgacctgttaaatgagtttcagttaaacagcaaaacgcttgaacggaaaaaaggc
tatattacctatttaaaagaggctgaaaagattacagagtttctgaacgtaattggcgct
cacaattcgcttctgcgatttgaggatgtcagaatcgttcgggacatgagaaattcggtc
aaccgcctcgtcaattgtgaaacagccaacttaaacaaaacgatcggcgcatcgctgaga
caggtggaaaatattaaatacatcgatgaaagaatcggcctggaggcgctgcctgaaaaa
cttcgggaaattgcgcagctgcggattgattatcaggaagtgacgctgaaagagctaggg
gaaatggtagcaagcgggaaaatcagcaaatcagggatcaatcacaggctgagaaaactt
gacgaaatcgcagaacagctgcggacagggcaaaccgtcactttaaaataa

DBGET integrated database retrieval system