KEGG   Bacillus subtilis subsp. subtilis 168: BSU34750
Entry
BSU34750          CDS       T00010                                 

Symbol
whiA
Name
(RefSeq) sporulation transcription regulator WhiA
  KO
K09762  cell division protein WhiA
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:bsu03036]
    BSU34750 (whiA)
Chromosome and associated proteins [BR:bsu03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Other chromosome partitioning proteins
    BSU34750 (whiA)
SSDB
Motif
Pfam: LAGLIDADG_WhiA WhiA_N HTH_WhiA Sigma70_r4 LAGLIDADG_3 Ribosomal_L14 TMP_3
Other DBs
NCBI-GeneID: 936540
NCBI-ProteinID: NP_391355
Pasteur: BG12402
BSORF: BG12402
UniProt: O06975 A0A6M4JPH2
Position
complement(3569573..3570523)
AA seq 316 aa
MSFASETKKELTNLEVKDCCINAELSALIRMNGALSFTNRHLVLDVQTENAAIARRIYTL
LKKQYDVSVELLVRKKMRLKKNNVYIVRFSENAKAILEDLKILGENFVFERSISKELVKK
RCCKRSYMRGAFLAGGSVNNPETSSYHLEIFSLYKEHNDSLCDLLNEFQLNSKTLERKKG
YITYLKEAEKITEFLNVIGAHNSLLRFEDVRIVRDMRNSVNRLVNCETANLNKTIGASLR
QVENIKYIDERIGLEALPEKLREIAQLRIDYQEVTLKELGEMVASGKISKSGINHRLRKL
DEIAEQLRTGQTVTLK
NT seq 951 nt   +upstreamnt  +downstreamnt
atgtcatttgcatcagaaacaaaaaaagaattaacgaatctggaagtgaaggactgctgc
attaatgccgagctgtctgcactcattcggatgaatggagctttatcatttacaaaccgc
catctcgtactcgatgttcaaaccgaaaacgcggcgattgcccgccgcatctatacattg
ctgaaaaaacaatatgatgtgtcggtcgagctgctggtcagaaagaaaatgcggctgaaa
aagaataacgtctatattgtgcgtttttcagaaaatgcaaaagcgatcttagaggattta
aaaatactcggggagaattttgtgtttgaacgaagtatttcgaaagagctggtcaaaaag
agatgctgcaagcgttcttatatgagaggagcatttttggcaggaggttcggtcaataac
ccggaaacctcctcgtatcatttagaaatcttctctctttataaggagcataacgattca
ttatgtgacctgttaaatgagtttcagttaaacagcaaaacgcttgaacggaaaaaaggc
tatattacctatttaaaagaggctgaaaagattacagagtttctgaacgtaattggcgct
cacaattcgcttctgcgatttgaggatgtcagaatcgttcgggacatgagaaattcggtc
aaccgcctcgtcaattgtgaaacagccaacttaaacaaaacgatcggcgcatcgctgaga
caggtggaaaatattaaatacatcgatgaaagaatcggcctggaggcgctgcctgaaaaa
cttcgggaaattgcgcagctgcggattgattatcaggaagtgacgctgaaagagctaggg
gaaatggtagcaagcgggaaaatcagcaaatcagggatcaatcacaggctgagaaaactt
gacgaaatcgcagaacagctgcggacagggcaaaccgtcactttaaaataa

DBGET integrated database retrieval system