KEGG   Bacillus subtilis subsp. subtilis 168: BSU34760Help
Entry
BSU34760          CDS       T00010                                 

Gene name
yvcK
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UPF0052
Motif
Other DBs
NCBI-GeneID: 936527
NCBI-ProteinID: NP_391356
Pasteur: BG12401
BSORF: BG12401
UniProt: O06974
Position
complement(3570546..3571499)
Genome map
AA seq 317 aa AA seqDB search
MGQKPKIAIFGGGTGLSVLLRGLKHKPVDITAIVTVADDGGSSGRLRNELKIPPPGDIRN
VLAALSDVEPLVEDLFQHRFNKGNDLTGHSLGNLILAAMTNITGDFFHAVTEMSKVLNVR
GKVLPAANASVVLHAEMEDGRVVSGESTIPEYGQRIKRVFLTPEQIDPLPETIDVIREAD
LIIIGPGSLYTSILPNLLVPKIGEEVIKAPAKKVYICNVMTQPGETLHYTAADHVKALNQ
HMGCGFIDTILVNSEDIPDEIKRKYEMESARPVDFDIEELKAMGLEVIRDQIVTYKNDVI
RHDTHKVASLLVDLLKE
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgggacaaaagccgaaaatcgcaatctttggcggcggtacaggtctttctgtattgctt
cggggcctaaagcataaacccgttgacatcacggccattgtaacagttgccgatgatggg
gggagctctggccgtctgcggaatgaactgaaaattccgcctcccggagacatcagaaat
gtgcttgccgctttatccgatgtggagccgcttgttgaagatctttttcagcaccgcttc
aataaagggaatgacttaacaggccattctctcgggaatttgattttggcagcgatgaca
aatataaccggtgatttttttcacgctgtcacagaaatgagcaaggtgctgaatgtaaga
ggaaaggttttgccggctgccaatgccagtgtcgttttgcatgctgagatggaagatggc
cgcgtggtctcaggcgagtcaacgatcccagaatacggacagcgcattaagcgtgttttt
ctcacgcctgaacagattgatccgctgccggaaacaatagacgtaatcagggaagcggat
ttgattattatcggcccgggaagcctctataccagcattcttcccaatttgctcgtccca
aaaatcggggaagaagtgataaaggcgccggcgaaaaaagtatacatttgcaacgtgatg
actcagcccggcgaaacgctccattacaccgctgctgatcatgtgaaagcgctcaatcag
catatgggctgtggttttattgatacgatattagtgaacagtgaagacattcccgacgaa
ataaaacgtaagtacgaaatggaatcggcgcgtcctgttgattttgatatcgaagagctg
aaagcgatggggcttgaagtcatcagagatcaaattgtaacgtataaaaatgacgtaata
cgtcacgatacacataaagtggcctctcttcttgttgatttactgaaagaatga

DBGET integrated database retrieval system