KEGG   Bacillus subtilis subsp. subtilis 168: BSU34760
Entry
BSU34760          CDS       T00010                                 

Symbol
yvcK
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: CofD
Other DBs
NCBI-GeneID: 936527
NCBI-ProteinID: NP_391356
Pasteur: BG12401
BSORF: BG12401
UniProt: O06974 A0A6M3ZIU3
Position
complement(3570546..3571499)
AA seq 317 aa
MGQKPKIAIFGGGTGLSVLLRGLKHKPVDITAIVTVADDGGSSGRLRNELKIPPPGDIRN
VLAALSDVEPLVEDLFQHRFNKGNDLTGHSLGNLILAAMTNITGDFFHAVTEMSKVLNVR
GKVLPAANASVVLHAEMEDGRVVSGESTIPEYGQRIKRVFLTPEQIDPLPETIDVIREAD
LIIIGPGSLYTSILPNLLVPKIGEEVIKAPAKKVYICNVMTQPGETLHYTAADHVKALNQ
HMGCGFIDTILVNSEDIPDEIKRKYEMESARPVDFDIEELKAMGLEVIRDQIVTYKNDVI
RHDTHKVASLLVDLLKE
NT seq 954 nt   +upstreamnt  +downstreamnt
atgggacaaaagccgaaaatcgcaatctttggcggcggtacaggtctttctgtattgctt
cggggcctaaagcataaacccgttgacatcacggccattgtaacagttgccgatgatggg
gggagctctggccgtctgcggaatgaactgaaaattccgcctcccggagacatcagaaat
gtgcttgccgctttatccgatgtggagccgcttgttgaagatctttttcagcaccgcttc
aataaagggaatgacttaacaggccattctctcgggaatttgattttggcagcgatgaca
aatataaccggtgatttttttcacgctgtcacagaaatgagcaaggtgctgaatgtaaga
ggaaaggttttgccggctgccaatgccagtgtcgttttgcatgctgagatggaagatggc
cgcgtggtctcaggcgagtcaacgatcccagaatacggacagcgcattaagcgtgttttt
ctcacgcctgaacagattgatccgctgccggaaacaatagacgtaatcagggaagcggat
ttgattattatcggcccgggaagcctctataccagcattcttcccaatttgctcgtccca
aaaatcggggaagaagtgataaaggcgccggcgaaaaaagtatacatttgcaacgtgatg
actcagcccggcgaaacgctccattacaccgctgctgatcatgtgaaagcgctcaatcag
catatgggctgtggttttattgatacgatattagtgaacagtgaagacattcccgacgaa
ataaaacgtaagtacgaaatggaatcggcgcgtcctgttgattttgatatcgaagagctg
aaagcgatggggcttgaagtcatcagagatcaaattgtaacgtataaaaatgacgtaata
cgtcacgatacacataaagtggcctctcttcttgttgatttactgaaagaatga

DBGET integrated database retrieval system