KEGG   Bacillus subtilis subsp. subtilis 168: BSU34770Help
Entry
BSU34770          CDS       T00010                                 

Gene name
yvcJ
Definition
(RefSeq) nucleotide-binding protein YvcJ
  KO
K06958  RNase adapter protein RapZ
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:bsu03019]
    BSU34770 (yvcJ)
Messenger RNA biogenesis [BR:bsu03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   Other RNA degradation factors
    Others
     BSU34770 (yvcJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP_bind_2 AAA_18 AAA_22 AAA_16 Myosin_head NB-ARC
Motif
Other DBs
NCBI-GeneID: 936532
NCBI-ProteinID: NP_391357
Pasteur: BG12400
BSORF: BG12400
UniProt: O06973
Position
complement(3571501..3572388)
Genome map
AA seq 295 aa AA seqDB search
MSVSESHDIQLVIITGMSGAGKTVAIQSFEDLGYFCVDNLPPSLLPKFLELMKESNSKMS
KVALVMDLRGREFFDRLIEALDEMAENPWITPRILFLDAKDSILVTRYKETRRSHPLAAT
GLPLEGIALERELLEELKGRSQIIYDTSDMKPRDLREKIVKHFATNQGETFTVNVMSFGF
KYGIPIDADLVFDVRFLPNPYYIESMRPLTGKDKEVSSYVMKWNETQKFNEKLIDLLSFM
LPSYKREGKSQVVIAIGCTGGQHRSVTLAENLADYFKKDYYTHVTHRDIEKRSRK
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgagtgttagtgaatcacatgatattcagcttgtcattataactggaatgtcgggagcg
gggaaaactgtcgcgatccaaagctttgaagatctcggctatttctgcgtcgataatctt
ccgccttcattgcttccgaagtttttagagctgatgaaggaatcaaattcgaaaatgagc
aaagttgcgctcgtgatggatttgcgcggccgcgaattttttgaccggctgattgaagcg
ctggatgaaatggccgaaaatccgtggatcacaccgcgaattttattcctggacgcgaag
gattccattctcgtcacaagatataaagaaacgagacgctcgcatccgctggcagcgact
ggcctgccgcttgaaggcatcgcgctagaacgagagctgcttgaggaattaaaaggccgc
tctcaaatcatttacgatacgtctgacatgaagccgcgtgatttgcgtgaaaaaatcgtg
aagcactttgcgacaaaccaaggagagacatttaccgtaaatgtgatgtcatttggtttt
aaatacggtattccaattgatgcagatctcgtctttgatgtcagatttttgccgaatccg
tactatatcgaaagcatgcggccgctgactggcaaggataaagaggtttcctcttacgtc
atgaagtggaatgaaacgcaaaagttcaatgagaaattaattgatctgctgagctttatg
cttccatcttacaaaagagaaggaaaaagccaggttgtcattgcgatcggctgcacaggg
ggccagcaccgctctgtgacattagccgagaatttagctgattatttcaaaaaggattac
tatactcatgttactcaccgggacattgaaaagagaagccggaaataa

DBGET integrated database retrieval system