KEGG   Bacillus subtilis subsp. subtilis 168: BSU34790
Entry
BSU34790          CDS       T00010                                 

Symbol
trxB
Name
(RefSeq) thioredoxin
  KO
K00384  thioredoxin reductase (NADPH) [EC:1.8.1.9]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00450  Selenocompound metabolism
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    BSU34790 (trxB)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.9  thioredoxin-disulfide reductase
     BSU34790 (trxB)
SSDB
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox DAO GIDA FAD_binding_2 FAD_oxidored NAD_binding_8 Thi4 HI0933_like Lys_Orn_oxgnase FAD_binding_3 Lycopene_cycl NAD_binding_7
Other DBs
NCBI-GeneID: 936549
NCBI-ProteinID: NP_391359
Pasteur: BG12398
BSORF: BG12398
UniProt: P80880 A0A6M3ZL10
Position
complement(3573207..3574157)
AA seq 316 aa
MSEEKIYDVIIIGAGPAGMTAAVYTSRANLSTLMIERGIPGGQMANTEDVENYPGFESIL
GPELSNKMFEHAKKFGAEYAYGDIKEVIDGKEYKVVKAGSKEYKARAVIIAAGAEYKKIG
VPGEKELGGRGVSYCAVCDGAFFKGKELVVVGGGDSAVEEGVYLTRFASKVTIVHRRDKL
RAQSILQARAFDNEKVDFLWNKTVKEIHEENGKVGNVTLVDTVTGEESEFKTDGVFIYIG
MLPLSKPFENLGITNEEGYIETNDRMETKVEGIFAAGDIREKSLRQIVTATGDGSIAAQS
VQHYVEELQETLKTLK
NT seq 951 nt   +upstreamnt  +downstreamnt
gtgtcagaagaaaaaatttatgacgtgattataatcggcgcgggccctgctgggatgacg
gccgctgtatacacatcaagagcgaatttatcgacattaatgattgaaagaggaattcct
ggcggacaaatggccaatacggaagatgtagaaaactatcctggattcgaaagtatcctt
gggcctgagctttctaacaaaatgtttgaacacgcgaaaaaattcggcgctgaatacgct
tatggcgatattaaagaggtcattgacggcaaagagtacaaagtagtcaaagctggttca
aaggaatataaagcccgtgctgtcatcattgctgcaggtgcggaatataaaaaaatcggc
gtgcctggcgaaaaagaattgggcggacgcggtgtatcttattgtgcagtatgtgacggc
gctttctttaaaggcaaagaacttgtcgttgttggcggcggagattccgcggttgaagaa
ggcgtatatctgactcgtttcgcttcaaaagtaacgattgttcacagacgtgataaactc
cgtgctcaaagtattcttcaagcgagagcatttgataatgaaaaagttgacttcctatgg
aacaaaactgtgaaggaaattcatgaggaaaacggcaaagtcggtaacgtaacgcttgtc
gatacggtaaccggtgaagaaagtgaattcaaaacagacggcgtattcatttacatcggc
atgcttcctctgtctaaaccgtttgaaaacctgggcattacgaatgaagaaggctatatc
gaaacaaacgaccgcatggaaactaaggttgaagggattttcgctgccggagacatccgc
gaaaaatcactgcgccaaatcgtaacggctacaggagacggaagcattgcggcacaaagc
gtacaacattatgtcgaagagctccaagaaacgctgaaaaccttaaaataa

DBGET integrated database retrieval system