KEGG   Bacillus subtilis subsp. subtilis 168: BSU34800
Entry
BSU34800          CDS       T00010                                 

Gene name
cwlO
Definition
(RefSeq) peptidoglycan DL-endopeptidase CwlO
  KO
K21471  peptidoglycan DL-endopeptidase CwlO [EC:3.4.-.-]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:bsu01002]
    BSU34800 (cwlO)
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bsu01011]
    BSU34800 (cwlO)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.-  Acting on peptide bonds (peptidases)
    3.4.-.-  
     BSU34800 (cwlO)
Peptidases and inhibitors [BR:bsu01002]
 Cysteine peptidases
  Family C40
   BSU34800 (cwlO)
Peptidoglycan biosynthesis and degradation proteins [BR:bsu01011]
 Peptidoglycan biosynthesis and degradation
  Endopeptidase
   BSU34800 (cwlO)
SSDB
Motif
Pfam: NLPC_P60 EzrA CHAP ERM ATG16 HAUS-augmin3 DUF4200 TMPIT
Other DBs
NCBI-GeneID: 936533
NCBI-ProteinID: NP_391360
Pasteur: BG11023
BSORF: BG11023
UniProt: P40767 A0A6M3ZHC2
Position
complement(3574363..3575784)
AA seq 473 aa
MRKSLITLGLASVIGTSSFLIPFTSKTASAETLDEKKQKIESKQSEVASSIEAKEKELTE
LQENQSKIEKELKDINDKALDTSNKIEDKKEENDKTKEEIKKLKKEIKETEARIEKRNEI
LKKRVRSLQESGGSQGYIDVLLGSTSFGDFISRATAVSSIVDADKDLIKQQEQDKAKLED
SEADLNDKLKEVQAALAKLETMQKDLDKQLNEKDKLFDEAKASQKKTAKAISELKSEASE
LANQKANTEAEQARIKKEQEAAAALIKKQEEAQKASDETQTDDSQTATTESSKASSSDDS
SDNSSDNSSNGSSNSSSNGSSSKKSSGSNSNSGGTVISNSGGIEGAISVGSSIVGQSPYK
FGGGRTQSDINNRIFDCSSFVRWAYASAGVNLGPVGGTTTDTLVGRGQAVSASEMKRGDL
VFFDTYKTNGHVGIYLGNGTFLNDNTSHGVSVDSMSNPYWKAAFKGVVRRVVQ
NT seq 1422 nt   +upstreamnt  +downstreamnt
gtgagaaagagtttaattacacttggtttggcttccgtcatcgggacaagcagttttttg
atcccatttacaagtaaaactgcatcggcggaaacattagatgaaaagaaacaaaaaatc
gaaagcaagcaatctgaggttgcttccagcattgaagcgaaggaaaaagaattaaccgag
cttcaggaaaatcaatcaaagattgaaaaagaactgaaagacattaacgataaggcgctt
gatacaagcaacaagattgaagataaaaaagaagaaaacgataaaacaaaagaagaaatc
aaaaaactgaaaaaagagattaaagaaactgaagcacgcatcgaaaaacgcaatgaaatc
ctgaaaaaacgcgttcgttctttacaggaaagcggcggatctcaaggatacatagatgtt
cttttaggatcaacaagctttggtgactttatctctcgtgcgactgcggtttcatctatt
gtggacgcagacaaagatttaatcaaacagcaagagcaggataaagcgaagctcgaagat
tctgaagcggatttgaatgacaagctgaaagaagttcaagctgccttggctaaattagaa
acaatgcaaaaagaccttgataaacagcttaatgaaaaagacaagcttttcgacgaagca
aaagcaagccaaaagaaaacggctaaagcgatttctgaattaaaatcagaggcgtctgaa
cttgcaaatcaaaaagcaaatactgaagctgaacaagcacgcatcaaaaaagaacaagaa
gcagcggctgctttgatcaaaaagcaggaagaagcacaaaaagcatctgatgaaacacaa
acagatgacagtcaaacggcgacaactgaatcatcaaaagcaagctcatctgatgattct
tcagacaattcttcagacaattcttctaacggttcatcaaacagttcgtcaaacggctca
tcttctaagaagagcagcggctcaaacagcaattcaggcggcactgttatcagcaactct
ggcggaattgaaggcgcgatcagcgttggttcaagcattgtaggacaatctccgtacaag
tttggcggcggacgcactcagtctgatatcaacaaccgtatttttgactgctcatcattc
gtacgctgggcatacgcttctgcaggtgttaaccttggacctgtaggcggaacaacaact
gatacgttagttggcagaggacaagctgtcagcgcgtctgaaatgaaacgcggagacctt
gtgttctttgacacttacaaaacaaatggacacgtaggaatctacttaggaaacggtact
ttcctaaacgacaatacatctcatggcgtatctgttgactctatgagcaatccttactgg
aaagcagcatttaaaggtgttgtaagacgtgttgttcaataa

DBGET integrated database retrieval system