KEGG   Bacillus subtilis subsp. subtilis 168: BSU34810
Entry
BSU34810          CDS       T00010                                 

Symbol
yvcD
Name
(RefSeq) TPR repeat-containing protein YvcD
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: TPR_19 TPR_2 TPR_16 TPR_1 TPR_17 TPR_6 TPR_9 TPR_14 TPR_15 TPR_10 ANAPC3 BTAD HTH_Tnp_4 TPR_11 Alkyl_sulf_dimr
Other DBs
NCBI-GeneID: 936542
NCBI-ProteinID: NP_391361
Pasteur: BG12396
BSORF: BG12396
UniProt: O06968 A0A6M4JPG9
Position
complement(3576165..3577619)
AA seq 484 aa
MGKHTSEHKNHAQIVQLLQDGQYFFHKGLKAYKERNLKRASKLIQRAVHLEPEDSEMLSQ
LAVIYSEMGQYQESNDLLDYIMANLEAEMPECHYFKANNFAHLGLFQEAYKEAAAYSDAD
PDGEFAEENDSLLDLLDLGDDGIEDSLYDQDELLVKQDRAKSLLESGQLAEAVAALEEIT
TEYPELWSAYNNLALAYFYSGNVVKAKQTAYEVLSHNEGNLHALCNLLVFYYYEREDEKV
AELSDQLSNVYPMLLEQRYKLGATLALVGRYEIGYKWLKSLYKTGFEGDDTFFYWLSCSA
YFTGHTDFAETIWRKVESQYPGEDRPAPWIERREALPSSVEQRLAAYYISSTKGETEHLE
AVIRSKRITAPFETHFVKLLLNGDSAAADVSEDALFAYQTVKLLEQAEKEEMKTEVMSCW
VFHVIQQIRAAAPLKNEKGWAAAICYIWKEAHGKQDTKKDTAARFGISPATLTKYMKYID
DILE
NT seq 1455 nt   +upstreamnt  +downstreamnt
gtgggaaaacacacttctgaacataaaaatcacgcacaaattgtccagctgcttcaagat
ggacaatatttttttcataaaggcttgaaagcgtataaagagcgcaatctaaaacgggca
agcaaactgattcagcgcgcggttcatttggagccggaggattcagagatgctttcacag
cttgcggtcatttattcggaaatgggccagtatcaagagtcgaacgatcttcttgactat
atcatggcaaatctggaggccgaaatgccggagtgccattactttaaagcgaataacttt
gcccatctggggctcttccaggaagcttataaagaagcggccgcttattctgatgcggac
ccggatggtgaattcgccgaagaaaacgatagtctgcttgatttgctcgatttaggagac
gacggcattgaggattcgttgtatgatcaggatgaactgctggtgaaacaggatcgggca
aagtcattgctggaaagcggccagcttgctgaagcggttgcggcgcttgaggaaatcaca
actgaatatccggagctttggtcagcatacaacaatctcgcgcttgcctatttctattca
ggaaacgttgtaaaagcgaagcaaaccgcttatgaagtgctttctcataatgaaggaaat
cttcacgccttatgcaatcttctcgttttctactattatgaaagagaagacgaaaaagtg
gcggaattgagtgatcagctctccaatgtctatccgatgctattggagcagcgttataaa
ttgggtgctactttggcgcttgtcggccgctacgagatcggatataaatggctcaaatca
ttatataaaaccggctttgagggtgacgacaccttcttttactggctttcctgctctgct
tattttacgggacataccgactttgccgagacgatctggagaaaagtcgagtcgcaatat
cccggcgaagaccgcccggcgccttggattgagcggagggaagctcttccttcatctgtg
gagcagcgactcgcagcctattatatcagcagcacaaagggagaaacagagcatcttgaa
gcggtgatacgctcaaagagaattaccgctccttttgaaactcattttgtaaagctgctt
ctgaatggagattctgcggctgctgacgtttcagaggatgcacttttcgcttatcaaacg
gtcaaactattagagcaagctgaaaaagaagagatgaaaacagaagtcatgagctgctgg
gtttttcatgtcatccagcaaattcgtgcagctgctccgttgaagaatgagaaaggctgg
gcagcagccatctgttatatttggaaagaagcccatggcaagcaagacacgaaaaaagac
acagcggcccgattcggcatctctccggcaactttgacgaaatatatgaaatatattgat
gatattctagaatag

DBGET integrated database retrieval system