KEGG   Bacillus subtilis subsp. subtilis 168: BSU34830Help
Entry
BSU34830          CDS       T00010                                 

Gene name
yvzA
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sec7_N KN17_SH3 DUF4570
Motif
Other DBs
NCBI-GeneID: 936541
NCBI-ProteinID: NP_391363
Pasteur: BG14157
BSORF: BG14157
UniProt: O32265
Position
complement(3579679..3580038)
Genome map
AA seq 119 aa AA seqDB search
MTSLFSESETEIVSTTYMFLTQDEMKGKAGTLNQPINDFLSLTKKFESSLKEEIKGQKGL
IVKKIKKELESNSEKRKAALQMIKEEHTAKVDRYKMIIEDLRQQDVTLTYRKKKPVKDV
NT seq 360 nt NT seq  +upstreamnt  +downstreamnt
gtgacttccttattttcagaaagtgaaacagaaattgtatcaacgacctatatgtttctt
acccaagatgaaatgaaggggaaagcgggcaccctcaatcaaccgatcaacgactttctc
agcctgacaaagaaatttgagtcttcattaaaagaggaaatcaaagggcaaaaagggttg
attgtaaaaaaaataaaaaaagagcttgagtctaatagcgaaaaacgaaaagctgccctt
cagatgataaaagaagaacataccgcaaaagttgatcggtacaaaatgataatagaagac
ctgcgacagcaggatgtaacattgacttacagaaaaaagaagccagtgaaagatgtctaa

DBGET integrated database retrieval system