KEGG   Bacillus subtilis subsp. subtilis 168: BSU34840Help
Entry
BSU34840          CDS       T00010                                 

Gene name
yvcB
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EB1_binding
Motif
Other DBs
NCBI-GeneID: 936563
NCBI-ProteinID: NP_391364
Pasteur: BG12394
BSORF: BG12394
UniProt: O06966
Position
complement(3580053..3581963)
Genome map
AA seq 636 aa AA seqDB search
MGNKNVFENENVKLRLIDLEYDYKQKFASTIASEVKKAKKDFEADIRRIYKEETHHDLPE
NMKIEIYTSNELVNQNTSIQSSTRESGYDGTAIHIIDEKKHIDQLQIISEGSADNKDWSY
NFFGLFLGIDHSQYEATKEFTNKAKKAAGNSEDLKTFALGHSLANNNQVMVQLIDGEYDE
VYGVNGAQVNIDQLLETDESLYRYVIRKFSYKYEDIDSIPPEKLKKEIQKYYEDKGVTTN
ITQRISKDDPLYGVSGKADFITFGDVKMADTNTSVKGIRNIMDGVPDEDVRSIQKFLQKY
KDDYEKDGLNGFIKAASGIDIDLIEKVKNTDGALKKVSVLYEHFDDVKQMYGRIKEELPS
FLGFLHTLLRNSGPVVDQLAENGYIDETQKKVIKKELTNINASMRGIESRYEHFIDHLKH
GQFMQALKDVGEIVDYVKSILSSLKTLDTETKDALKLIVDGHSIVQMLNALSKEKGFSYK
GSDIYFTGKSGSGETIQVNLSSAVRIYQNGMKIVEDMEDAISKYQKVYSQEIDEDFIDKK
QAIITAIHHMEENPSHYAFDLQFRLAAGFSHTFDKLEKISVHESFHTGALPANDGIVAEL
KKQTTEKRDFIKNIRESIEKLFEKEEMISQLFDFQS
NT seq 1911 nt NT seq  +upstreamnt  +downstreamnt
atgggaaataaaaatgtatttgagaatgagaacgtaaagttaaggttaattgatttagaa
tatgactataaacaaaagtttgcctcaactattgcgagtgaagttaagaaagctaagaag
gatttcgaagcagatatacgcagaatttataaagaggaaacccaccacgatcttcctgag
aatatgaaaattgaaatttacacctccaatgaacttgtaaatcagaatacaagtatacaa
agttcgaccagagaatcaggttacgatggaacggcaatccatataatagatgagaaaaaa
catattgatcagcttcagattatttcagaaggtagtgccgataataaggattggtcatat
aacttttttggtctttttttaggaattgatcatagtcagtatgaggctacaaaggagttt
actaacaaagcaaagaaagcagcaggtaactctgaggatttaaaaacattcgccttagga
cattcacttgcaaataataaccaagttatggtgcaattgattgatggagaatatgatgaa
gtttatggggtaaatggagctcaagtcaatattgatcaattacttgaaactgatgaaagt
ttatatagatatgttattaggaaatttagttataaatatgaagatatagattccatcccg
ccagaaaagttaaaaaaagaaatccaaaaatattatgaagacaaaggcgtaacaacaaac
atcactcagcgcatctcaaaagatgacccgctgtatggagtcagcggcaaggccgatttt
attacattcggtgatgtgaagatggcagatacaaatacaagtgtaaaaggcatccgaaac
attatggatggggttcctgacgaagatgtgaggtcaattcaaaaattccttcaaaaatat
aaggatgactatgaaaaagacggcttgaacggttttataaaggcagccagcgggatagac
atagacctgattgaaaaagtgaaaaacacagacggcgctttaaagaaagtaagtgtccta
tatgagcattttgatgatgttaagcaaatgtatggccgaataaaagaggaactgccgtcg
tttttaggttttcttcataccttgttgagaaacagcggaccggtcgtagatcagttagct
gaaaatggttatattgatgaaacgcaaaagaaagtcatcaaaaaagaattaacgaatatt
aatgcgagtatgcgaggcatagagtcacggtacgaacatttcatagaccatctaaaacat
ggccaatttatgcaagctttaaaagacgttggtgaaatagtggactatgtaaaatcaatt
ctgtcctcattgaaaacactcgacacagaaacaaaagacgcactaaaacttatcgtcgac
ggccacagcatcgttcaaatgctcaacgccttgtcaaaggaaaaaggcttcagctataaa
ggctccgatatttattttacagggaagagtggctcgggagaaacgattcaagtcaatctc
tcatccgctgtcagaatctatcaaaacggtatgaaaatcgttgaagatatggaagatgcg
atttctaagtaccagaaggtttacagtcaggaaatcgatgaagacttcatagacaaaaag
caggcgatcatcacggctattcatcatatggaagaaaacccttcgcattatgccttcgat
cttcaattccggcttgcagctggtttcagccacacattcgataaattggagaaaatctca
gttcatgaatcattccacacaggtgcgcttcctgcaaatgatggaattgttgctgaatta
aaaaaacagacaacagaaaaaagagattttatcaaaaatatccgcgagagtattgaaaag
ctgtttgaaaaagaagaaatgatttctcagttatttgattttcagtcttag

DBGET integrated database retrieval system